SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000032876 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000032876
Domain Number 1 Region: 21-144,176-263
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 1.88e-69
Family Calponin-homology domain, CH-domain 0.0000365
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000032876   Gene: ENSMMUG00000001631   Transcript: ENSMMUT00000039809
Sequence length 285
Comment pep:novel chromosome:MMUL_1:7:126866509:126980677:1 gene:ENSMMUG00000001631 transcript:ENSMMUT00000039809 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASSPELPTEDEQVSWAIDDLHISLQAEQEDTQKKAFTCWINSQLARHTSPSVISDLFTD
IKKGHVLLDLLEVLSGQQLPRDKGSNTFQCRINIEHALTFLRNRSIKLINIHVTDIIDGN
PSIILGLIWTIILHFHIEKLAQTLPCNYNQPSLDDVSVVDSSPTSSPPAKKCSKVQARWQ
MSAKKALLLWAQEQCATYESVNVTDFKSSWRNGMAFLAIIHALRPDLIDMKSVKHRSNKD
NLREAFRIAERELKIPRLLEPEDAWRSSVLYRIYMPGTVSYASYL
Download sequence
Identical sequences A0A2I3MW97 A0A2K5LB44 A0A2K5WUS9 A0A2K5XMI2 F7GS21
ENSMMUP00000032876 ENSMMUP00000002182 9544.ENSMMUP00000032876

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]