SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000032923 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000032923
Domain Number 1 Region: 29-123
Classification Level Classification E-value
Superfamily Family A G protein-coupled receptor-like 0.00000000000558
Family Rhodopsin-like 0.0052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000032923   Gene: ENSMMUG00000029360   Transcript: ENSMMUT00000039862
Sequence length 196
Comment pep:known scaffold:MMUL_1:1099214734647:1161:1953:1 gene:ENSMMUG00000029360 transcript:ENSMMUT00000039862 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVLFIYLLCSHAVFFSFLSLPPARVCPGLIVVTLAVCWMPNQIRRIMAAAKPKHDWTRSY
FRAYMILLPFSDTFFYLSSVINPLLYTVSSQQFRRVFVQVLCCRLSLQHANHEKRLRAHA
HSSTDSARFMQRPLLFVASWRHSSARRTKKVFLSTFQSEAEPQSKSQPLNLESLEPNSGT
KLADFAAENGFQEHEV
Download sequence
Identical sequences ENSMMUP00000032923 ENSMMUP00000032923 9544.ENSMMUP00000032923

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]