SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000033020 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000033020
Domain Number 1 Region: 25-89
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 3.56e-18
Family Protein kinases, catalytic subunit 0.00019
Further Details:      
 
Domain Number 2 Region: 2-42
Classification Level Classification E-value
Superfamily SH2 domain 0.0000161
Family SH2 domain 0.00084
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000033020   Gene: ENSMMUG00000017017   Transcript: ENSMMUT00000039957
Sequence length 89
Comment pep:known_by_projection chromosome:MMUL_1:4:152233231:152241744:1 gene:ENSMMUG00000017017 transcript:ENSMMUT00000039957 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RKLDNGGYYITTRAQFETLQQLVQHYSGSLLDFLKDGEGRALKLPNLVDMAAQVAAGMAY
IERMNYIHRDLRSANILVGNGLICKIADF
Download sequence
Identical sequences ENSMMUP00000033020

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]