SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000033024 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000033024
Domain Number 1 Region: 68-135
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000000091
Family Growth factor receptor domain 0.0055
Further Details:      
 
Domain Number 2 Region: 132-173
Classification Level Classification E-value
Superfamily FnI-like domain 0.0000534
Family VWC domain 0.079
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000033024   Gene: ENSMMUG00000012582   Transcript: ENSMMUT00000039961
Sequence length 231
Comment pep:known_by_projection chromosome:MMUL_1:4:151873509:151889192:-1 gene:ENSMMUG00000012582 transcript:ENSMMUT00000039961 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNKRRLLYPSGWLHGPSDMRGLLFSTLLLADLAQFCCRAQGTGPLDTTPEGRPGEVSDAH
QRKQFCHWPCKCPHQKPHCPPGVSLVRDGCGCCKICAKQPGEICNEADLCDPHKGLYCDY
SVDRPRYETGVCAYLVAVGCEFNQVHYHNGQVFQPNPLFSCLCVSGAIGCTPLFIPKLAD
GHCSGAKGGKKSDQSNCGLEPLLQQLSTSYKTMPDVCQASNLLPANYFRGL
Download sequence
Identical sequences A0A2K5WKZ8
ENSMMUP00000033024

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]