SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000033030 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000033030
Domain Number 1 Region: 17-59
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000126
Family Laminin-type module 0.011
Further Details:      
 
Weak hits

Sequence:  ENSMMUP00000033030
Domain Number - Region: 76-103
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000368
Family EGF-type module 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000033030   Gene: ENSMMUG00000013782   Transcript: ENSMMUT00000039967
Sequence length 117
Comment pep:known chromosome:MMUL_1:4:151724583:151740809:1 gene:ENSMMUG00000013782 transcript:ENSMMUT00000039967 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
KCNAGFFRTLSGECVPCDCNGNSNECLDGSGFCVHCQRNTTGEHCEKCLDGYIGDSIRGA
PRFCQLCPCPLPHLANFAESCYRKNGAVRCICKENYAGPNCERPSPQSSRGFPLNDS
Download sequence
Identical sequences ENSMMUP00000033030

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]