SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000033060 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000033060
Domain Number 1 Region: 65-166
Classification Level Classification E-value
Superfamily PUG domain-like 0.000000000000222
Family PUG domain 0.0044
Further Details:      
 
Domain Number 2 Region: 352-377
Classification Level Classification E-value
Superfamily Ran binding protein zinc finger-like 0.0000188
Family Ran binding protein zinc finger-like 0.0029
Further Details:      
 
Weak hits

Sequence:  ENSMMUP00000033060
Domain Number - Region: 302-327
Classification Level Classification E-value
Superfamily Ran binding protein zinc finger-like 0.000497
Family Ran binding protein zinc finger-like 0.0029
Further Details:      
 
Domain Number - Region: 215-246
Classification Level Classification E-value
Superfamily Cysteine-rich domain 0.00377
Family TFIIH p44 subunit cysteine-rich domain 0.046
Further Details:      
 
Domain Number - Region: 409-434
Classification Level Classification E-value
Superfamily Ran binding protein zinc finger-like 0.00377
Family Ran binding protein zinc finger-like 0.0043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000033060   Gene: ENSMMUG00000012474   Transcript: ENSMMUT00000039995
Sequence length 572
Comment pep:known chromosome:MMUL_1:7:87041137:87045030:1 gene:ENSMMUG00000012474 transcript:ENSMMUT00000039995 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPGEEEERAFLVAREELASALRRDSGQAFSLEQLRPLLASSLPPTARYLQLDAARLVRCN
AHGEPRNYLSTLSTALNILEKYGRNLLSPQRPRYWRGVKFNNPVFRSTVDAVQGGRDVLR
LYGYTEEQPDGLSFPEGQEEPNEHQVATVTLEVLLLRTELSLLLQNTHPRQQALEQLLED
KVEDDMLQLSEFDPLLREIAPGPLTTPSAPGSTPGPCFLCGSAPGTLHCPSCKQALCPAC
DHLFHGHPSRAHHLRQTLPGVLQGTHLSPSLPASAQPRPQSTSLLALGDSSLSSPNPASA
RLPWHCAACAMLNEPWAVLCVACDRPRGCKGLGLGTEGAQGTGGLEPDLARGRWACQSCT
FENEAAAVLCSICERPRLAQPPSLVVDSRDAGICLQPLQQGDTLLASAQSHVWYCIHCTF
CNSSPGWVCVMCNRTSSPIPVQRAPRPYASSLEKGPPKLGPPQRLSASLPSSCGDPGKQR
QDKMREEGLQLVSMIRAGKPQVPVQRRSSRLCSTRALRCLCSGCAQNCPTCWRWWLSWLD
SRTLGWVPFPVRRPGKPGWIVMATLMKLWRNV
Download sequence
Identical sequences ENSMMUP00000033060

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]