SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000033100 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000033100
Domain Number 1 Region: 70-193
Classification Level Classification E-value
Superfamily Cadherin-like 1.86e-23
Family Cadherin 0.00092
Further Details:      
 
Domain Number 2 Region: 180-284
Classification Level Classification E-value
Superfamily Cadherin-like 0.0000000000118
Family Cadherin 0.005
Further Details:      
 
Domain Number 3 Region: 2-75
Classification Level Classification E-value
Superfamily Cadherin-like 0.00000157
Family Cadherin 0.0035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000033100   Gene: ENSMMUG00000006009   Transcript: ENSMMUT00000040030
Sequence length 477
Comment pep:known chromosome:MMUL_1:7:85876765:85884076:-1 gene:ENSMMUG00000006009 transcript:ENSMMUT00000040030 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAYSILDGEGSEAFSISTDSQGRDGLLTVRKPLDFESRRSYAFRVEATNTLIDPAYLRRG
PFKDVASVRVVVQDAPEPPAFTQAAYHLTVPENKAPGTLVGQISAADLDSPASPIRYSIL
PHSDPERCFSIQPEEGTIHTAAPLDREARVWHNLTVLATELDSSAQASRVQVTIQTLDEN
DNAPQLAEPYDTFVCDSAAPGQLIQVIQALDRDEVGNSSHVSFQGPLGPDANFTVRDNRD
GSASLLLPSRPAPPRQAPYLVPIELWDWGQPALSSTATVTVSVCRCQPDGSVASCWPEAH
LSAAGLSTGALLAIITCVGALLALVVLFVALRRQKQEALMVLEEEDVRENIITYDDEGGG
EEDTEAFDITALQNPDGAAPQAPGPPARRDVLPRARVSRQPRPPGPADVAQLLVLRLREA
DEDPSPAASPAPRSRWTTGVRSSAPWRSCMGPKSPRPPERPRWPGPPRGGSRHRPSE
Download sequence
Identical sequences ENSMMUP00000033100

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]