SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000033101 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000033101
Domain Number 1 Region: 196-577
Classification Level Classification E-value
Superfamily Alkaline phosphatase-like 3.6e-103
Family Phosphonoacetate hydrolase 0.02
Further Details:      
 
Domain Number 2 Region: 672-911
Classification Level Classification E-value
Superfamily His-Me finger endonucleases 2e-24
Family DNA/RNA non-specific endonuclease 0.011
Further Details:      
 
Domain Number 3 Region: 105-150
Classification Level Classification E-value
Superfamily Somatomedin B domain 0.00000000523
Family Somatomedin B domain 0.002
Further Details:      
 
Domain Number 4 Region: 151-191
Classification Level Classification E-value
Superfamily Somatomedin B domain 0.000000824
Family Somatomedin B domain 0.0053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000033101   Gene: ENSMMUG00000014151   Transcript: ENSMMUT00000040031
Sequence length 925
Comment pep:known_by_projection chromosome:MMUL_1:4:131997842:132079169:-1 gene:ENSMMUG00000014151 transcript:ENSMMUT00000040031 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MERDGCAGGGSRGGEGGRAPREGPAGNSRDRGRSHAAEAPGDPQAAASLLAPMDVGEEPL
EKAARARTAKDPNTYKVLSLVLSVCVLTTILGCIFGLKPSCAKEVKSCKGRCFERTFGNC
RCDAACVELGNCCLDYQETCIEPEHIWTCNKFRCGEKRLTRSLCACSDDCKDQGDCCINY
SSVCQGEKSWVEEPCESINEPQCPAGFETPPTLLFSLDGFRAEYLHTWGGLLPVISKLKK
CGTYTKNMRPVYPTKTFPNHYSIVTGLYPESHGIIDNKMYDPKMNASFSLKSKEKFNPEW
YKGEPIWVTAKYQGLKSGTFFWPGSDVEINGIFPDIYKMYNGSVPFEERILAVLQWLQLP
KDERPHFYTLYLEEPDSSGHSYGPVSSEVIKALQRVDNMVGMLMDGLKELNLHRCLNLIL
VSDHGMEQGSCKKYIYLNKYLGDVKNIKVIYGPAARLRPSDVPDKYYSFNYEGIARNLSC
REPNQHFKPYLKHFLPKRLHFAKSDRIEPLTFYLDPQWQLALNPSERKYCGSGFHGSDNI
FSNMQALFVGYGPGFKHGIEVDTFENIEVYNLMCDLLNLTPAPNNGTHGSLNHLLKNPVY
TPKHPKEVHPLIQCPFTRNPRDNLGCSCNPSILPIEDFQTQFNLTVAEEKNIKHETLPYG
RPRVLQKKNTICLLSQHQFMSGYSQDILMPLWTSYTVDRNDSFSTEDFSNCLYQDFRISL
SPVHKCSFYKNNTKVSYGFLSPPQLNKNSSGIYSEALLTTNIVPMYQSFQVIWRYFHDTL
LRKYAEERNGVNVVSGPVFDFDYDGRYDSLEILRQKRRVIRNQEILIPTHFFIVLTSCKD
ASQTPLHCENLDTLAFILPHRTDNSESCVHGKHESSWIEELLMLHRARITDVEHITGLSF
YQQRKEPVSDILKLKTHLPTFSQED
Download sequence
Identical sequences ENSMMUP00000033101

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]