SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000033231 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000033231
Domain Number 1 Region: 12-142,173-195
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 8.91e-47
Family Calponin-homology domain, CH-domain 0.0000295
Further Details:      
 
Domain Number 2 Region: 538-680
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000000000903
Family Spectrin repeat 0.01
Further Details:      
 
Domain Number 3 Region: 1068-1206
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000000863
Family Spectrin repeat 0.01
Further Details:      
 
Weak hits

Sequence:  ENSMMUP00000033231
Domain Number - Region: 867-987
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000575
Family Spectrin repeat 0.0092
Further Details:      
 
Domain Number - Region: 767-901
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00125
Family Spectrin repeat 0.025
Further Details:      
 
Domain Number - Region: 1289-1414
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00504
Family Spectrin repeat 0.016
Further Details:      
 
Domain Number - Region: 362-444
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0432
Family Spectrin repeat 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000033231   Gene: ENSMMUG00000019048   Transcript: ENSMMUT00000040155
Sequence length 1421
Comment pep:known chromosome:MMUL_1:4:110426748:110640908:1 gene:ENSMMUG00000019048 transcript:ENSMMUT00000040155 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MATSRGASRCPRDIANVMQRLQDEQEIVQKRTFTKWINSHLAKRKPPMVVDDLFEDMKDG
VKLLALLEVLSGQKLPCEQGRRMKRIHAVANIGTALKFLEGRKIKLVNINSTDIADGRPS
IVLGLMWTIILYFQIEELTSNLPQLQSLSSSASSVDSIVSSETPSPPSKRKVTTKIQGNA
KKALLKWVQYTAGKHYILMESQDIFTKSMLLYNGACHYFDLDTFIHQITWYISKRYHVPR
VFSVHMEIVIPNISLNSNIDKSPNGILGVTPQIQKFFRDNTNKIIMSPCFQREDRLILKE
MKVWIEQFERDLTRAQMVESNLQDKYQSFKHFRVQYEMKRKQIEHLVQPLHRDGKLSLDQ
ALVKQSWDRVTSRLFDWHIQLDKSLPAPLGTIGAWLYRAEVALREEITIQQVHEETANTI
QRKLEQHKDLLQNTDAHKRAFHEIYRTRSVNGIPVPPDQLEDMAERFHFVSSTSELHLMK
MEFLELKYRLLSLLVLAESKLKSWIIKYGRRESVEQLLQNYVSFIENSKFFEQYEVTYQI
LKQTAEMYVKADGSVEEAENVMKFMNETTAQWRNLSVEVRSVRSMLEEVISNWDRYGNTV
ASLQAWLEDAEKMLNQSEIAKKDFFRNLPHWIQQHTAMNDAGNFLIETCDEMVSRDLKQQ
LLLLNGRWRELFMEVKQYAQADEMDRMKKEYTDCVVNLSAFATEAHKKLCEPLEVSFMNV
KLLIQDLEDIEQRVPVMDAQYKIITKTAHLITKESPQEEGKEMFATMSKLKEQLTKVKEC
YSPLLYESQQLLIPLEELEKQMTSFYDSLGKINEIITVLEREAQSSALFKQKHQELLACQ
ENCKKTLTLIEKGSQSVQKFVTLSNVLKHFDQTRLQRQIADVHVAFQSMVKKTGDWKKHV
ETNSRLMKKFEESRAELEKVLRIAQEGLEEKGDPEELLRRHTEFFSQLDQRVLNAFLKAC
DELTDILPEQEQQGLQEAVRKLHKQWKVSQDRTETPLSVLRSKCKRNLEIPGKTQDAEVA
VSQDLTTVLQPGSEKIIKEHVFFSDKGPHHLCEKRLQLIEELCVKLPVRDPVRDTPGTCH
ATLKELRAAIDSTYRKLMEDPDKWKDYTNRFSEFSSWISTNETQLKGIKGEAIDTANHRE
VKRAVEEIRNGVTKRGETLSWLKSRLKVLTEVSSENQAQKQGDELAKLSSSFKALVTLLS
EVEKMVSNFGDCVQYKEIVKNSLEELISGSKEVQEQAEKILDTENLFEAQQLLLHHQQKT
KRISAKKRDVQQQIAQAQQEEGGLPDRGREELRKLESTLDGLERSRERQERRIQVTLRKW
ERFETNKETVVRYLFQTGSSHERFLSFSSLESLSSELEQTKEFSKRTENIAVQAENLVKE
ASEIPLGPQNKQLLQQQAQSIKEQVKKLEDTLEEEYVIDKS
Download sequence
Identical sequences ENSMMUP00000033231

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]