SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000033491 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000033491
Domain Number 1 Region: 13-198
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 7.04e-22
Family Laminin G-like module 0.003
Further Details:      
 
Domain Number 2 Region: 275-305
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000248
Family EGF-type module 0.036
Further Details:      
 
Weak hits

Sequence:  ENSMMUP00000033491
Domain Number - Region: 226-268
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000113
Family EGF-type module 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000033491   Gene: ENSMMUG00000029595   Transcript: ENSMMUT00000040431
Sequence length 311
Comment pep:known_by_projection chromosome:MMUL_1:4:60197040:60246038:-1 gene:ENSMMUG00000029595 transcript:ENSMMUT00000040431 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
NGVSKIPLSIFCCPLGVNYPLCRKTINITQPRFSGTDAFGYTSFLAYSRISDISFHYEFH
LKFQLANNHSALQNNLIFFTGQKGHGLNGDDFLAVGLLNGSVVYSYNLGSGIASIRSDPL
NLSLGVHTVHLGKFFQEGWLKVDDHKNKSIIAPGRLVGLNVFSQFYVGGYSEYTPDLLPN
GADFKNGFQGCIFTLQVRTEKDGHFRGLGNPEGHPNAGRSVGQCHASPCSLMKCGNGGTC
IESGTSVYCNCTTRWKGAFCTETVSICDPEHDPPHHCSRGATCISLPHGYTCFCPLGTTG
IYCEQGKAEFQ
Download sequence
Identical sequences ENSMMUP00000033491 ENSMMUP00000033491 9544.ENSMMUP00000033491

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]