SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000033561 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000033561
Domain Number 1 Region: 100-197
Classification Level Classification E-value
Superfamily GST C-terminal domain-like 4.82e-19
Family Glutathione S-transferase (GST), C-terminal domain 0.0000248
Further Details:      
 
Domain Number 2 Region: 19-97
Classification Level Classification E-value
Superfamily Thioredoxin-like 2.2e-16
Family Glutathione S-transferase (GST), N-terminal domain 0.00029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000033561   Gene: ENSMMUG00000003511   Transcript: ENSMMUT00000040504
Sequence length 205
Comment pep:novel chromosome:MMUL_1:4:45789243:45890691:-1 gene:ENSMMUG00000003511 transcript:ENSMMUT00000040504 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTDSATANGDDRDPEIELFVKAGIDGESIGNCPFSQRLFMILWLKGVVFNVTTVDLKRKP
ADLHNLAPGTHPPFLTFNGDVKTDVNKIEEFLEETLTPEKYPKLAAKHRESNTAGIDIFS
KFSAYIKNTKQQNNAALERGLTKALKKLDDYLNTPLPEEIDASTCGEDKGSRRKFLDGDE
LTLADCNLLPKLHVVKEQVPLKGMI
Download sequence
Identical sequences A0A2K5UCG4 A0A2K6DFU3 F7GTS5
ENSMMUP00000033561

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]