SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000033633 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000033633
Domain Number 1 Region: 73-105
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.00000000000333
Family LIM domain 0.0018
Further Details:      
 
Weak hits

Sequence:  ENSMMUP00000033633
Domain Number - Region: 2-25
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.00157
Family LIM domain 0.01
Further Details:      
 
Domain Number - Region: 57-72
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.0317
Family LIM domain 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000033633   Gene: ENSMMUG00000022942   Transcript: ENSMMUT00000040583
Sequence length 109
Comment pep:known_by_projection chromosome:MMUL_1:4:43202052:43203890:-1 gene:ENSMMUG00000022942 transcript:ENSMMUT00000040583 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
HKPCYGALFGPRGVNIGGVGSYLYNAPTPSPGSTTSLSPSSFSPPRPRTGLPQGKKTEKV
MSLGRNWHRPCLRCQRCRKTLTAGSHAEHDGVPYCHVPCYGYLFGPKGG
Download sequence
Identical sequences ENSMMUP00000033633

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]