SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000033635 from Macaca mulatta 76_1

(show help)
Strong hits

Sequence:	ENSMMUP00000033635
Domain Number 1	Region: 31-78
Classification Level	Classification	E-value
Superfamily	Glucocorticoid receptor-like (DNA-binding domain)	0.0000000000000182
Family	LIM domain	0.0014
Further Details:

Domain Number 2	Region: 111-149
Classification Level	Classification	E-value
Superfamily	Glucocorticoid receptor-like (DNA-binding domain)	0.00000000000507
Family	LIM domain	0.011
Further Details:

Domain Number 3	Region: 150-182
Classification Level	Classification	E-value
Superfamily	Glucocorticoid receptor-like (DNA-binding domain)	0.0000000000116
Family	LIM domain	0.0018
Further Details:

Domain Number 4	Region: 4-30
Classification Level	Classification	E-value
Superfamily	Glucocorticoid receptor-like (DNA-binding domain)	0.00000000163
Family	LIM domain	0.0088
Further Details:

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by

Cellular Component	IC (bits)	H-Score

Biological Process	IC (bits)	H-Score

Molecular Function	IC (bits)	H-Score

External link(s)	Protein: ENSMMUP00000033635 Gene: ENSMMUG00000022942 Transcript: ENSMMUT00000040585
Sequence length	194
Comment	pep:known_by_projection chromosome:MMUL_1:4:43201970:43204803:-1 gene:ENSMMUG00000022942 transcript:ENSMMUT00000040585 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence	MSWTCPRCQQPVFFAEKVSSLGKNWHRFCLKCERCHSVLSPGGHAEHNGRPYCHKPCYGA LFGPRGVNIGGVGSYLYNAPTPSPGSTTSLSPSSFSPPRPRTGLPQGKKSPPHMKTFTGE TSLCPGCGEPVYFAEKVMSLGRNWHRPCLRCQRCRKTLTAGSHAEHDGVPYCHVPCYGYL FGPKGGQPHSRHWA
Download sequence
Identical sequences	ENSMMUP00000033635

SEARCH