SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000033713 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000033713
Domain Number 1 Region: 34-124
Classification Level Classification E-value
Superfamily Immunoglobulin 4.62e-16
Family V set domains (antibody variable domain-like) 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000033713   Gene: ENSMMUG00000013920   Transcript: ENSMMUT00000040675
Sequence length 238
Comment pep:known chromosome:MMUL_1:4:40981763:40986454:-1 gene:ENSMMUG00000013920 transcript:ENSMMUT00000040675 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ALGQGRVAWSLSGCSSYSLPQALSGAHNTTVFQGVEGQSLQVSCPYDSMKHWGRRKAWCR
QLGEKGPCQRVVSTHNLWLLSFLRRRNGSTAITDDTLGGTLTITLRNLQPHDAGFYQCQS
LHGSEADTLRKVLVEVLADPLDHRDAGDLWVPGESESFEDAHVEHSISRSLLEGEIPFPP
TSVLLLLACIFLIKILAASALWAAAWHGQKPGTHPPSEPDCGHDPGHQLQTLPGLRDT
Download sequence
Identical sequences ENSMMUP00000033713

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]