SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000033748 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000033748
Domain Number 1 Region: 1-126
Classification Level Classification E-value
Superfamily Cysteine proteinases 5.89e-28
Family Transglutaminase core 0.00018
Further Details:      
 
Domain Number 2 Region: 140-222
Classification Level Classification E-value
Superfamily Transglutaminase, two C-terminal domains 0.00000000000000194
Family Transglutaminase, two C-terminal domains 0.0063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000033748   Gene: ENSMMUG00000022255   Transcript: ENSMMUT00000040713
Sequence length 257
Comment pep:known_by_projection chromosome:MMUL_1:7:21641257:21660182:-1 gene:ENSMMUG00000022255 transcript:ENSMMUT00000040713 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTRPALPQGYDGWQILHSSAPNGGGVLGFCDLVPVRAVKEGTLRLTPAVSDLFAAINASC
VVWKCCEDGKLELTDSNTKYVGNNISTKGVGSDRCEDITQNYKYPEGSLQEKEVLERVEK
EKMEHGKDNGIRPPTLQTANPLYLLLKAPSSLPLRGDTQISVTLVNHSEQEMAVLLAIGV
QAVHYNGVLAAELWRKKLHLMLSANLDARESRAVSTPHSLSQHPELHRCPHGGLCDLHPG
KGAHSQREEVQIWFSAA
Download sequence
Identical sequences ENSMMUP00000033748

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]