SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000033750 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSMMUP00000033750
Domain Number - Region: 458-482
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0179
Family EGF-type module 0.074
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000033750   Gene: ENSMMUG00000029716   Transcript: ENSMMUT00000040715
Sequence length 495
Comment pep:known chromosome:MMUL_1:6:164115717:164484565:1 gene:ENSMMUG00000029716 transcript:ENSMMUT00000040715 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVSPPLLIISVAGIIECKPDRLLWRPGSTSPQSVSFLHGKVVMESLGRPIPPTSSPSLLP
SAQLPSSHNPPPVSCQMPLLDSNTSHQIMDTNPDEEFSPNSYLLRACSGPQQASSSGPPN
HHSQSTLRPPLPPPHNHTLSHHHSSANSLNRNSLTNRRSQIHAPAPAPNDLATTPESVQL
QDSWVLNSNVPLETRHFLFKTSSGSTPLFSSSSPGYPLTSGTVYTPPPRLLPRNTFSRKA
FKLKKPSKYCSWKCAALSAIAAALLLAILLAYFIAMHLLGLNWQLQPADGHTFNNGIRTG
LPGNDDVATMPSGGKVPWSLKNSSIDSGEAEVGRRVTQEVPPGVFWRSQIHISQPQFLKF
NISLGKDALFGVYIRRGLPPSHAQYDFMERLDGKEKWSVVESPRERRSIQTLVQNEAVFV
QYLDVGLWHLAFYNDGKDKEMVSFNTVVLDSVQDCPRNCHGNGECVSGVCHCFPGFLGAD
CAKAACPVLCSGNGQ
Download sequence
Identical sequences ENSMMUP00000033750 9544.ENSMMUP00000033750 ENSMMUP00000033750

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]