SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000033803 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000033803
Domain Number 1 Region: 635-679
Classification Level Classification E-value
Superfamily SpoIIaa-like 0.000000334
Family Anti-sigma factor antagonist SpoIIaa 0.0085
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000033803   Gene: ENSMMUG00000008442   Transcript: ENSMMUT00000040777
Sequence length 715
Comment pep:known_by_projection chromosome:MMUL_1:4:35698137:35765757:-1 gene:ENSMMUG00000008442 transcript:ENSMMUT00000040777 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLTIFPFLEWMCMYRLKDWLLGDLLAGISVGLVQVPQGLTLSLLARQLIPPLNIAYAAFC
SSVIYVIFGSCHQMSIGSFFLVSALLINVLKISPFNNGHLVMGSFLKDEFSAPSYLMGYN
KSLSVVATTTFLTGIIQLIMGVLGLGFIATYLPESAMSAYLAAVALHIMLSQLTCIFGIM
ISFHAGPISFFYDIINYCVALPKANSTSILLFLTVVVALRINKCIRISFNQYPIEFPMEL
FLIIGFTVIANKITMATETSQTLIDMIPYSFLFPVTPDFSVLPKIILQAISLSLVSSFLL
IFLGKKIASLHNYSVNSNQDLIAIGLCNVVSSFFRSCVFTGAVARTIIQDKSGGRQQFAS
LVGAGVMLLLMVKMGHFFYALPNAVLAGIILSNVVPYLETISNLPSLWRQDQYDCAMDLK
NTNSSLMPSAPVLLYKGESRLLVQENTKTSFQLRQIKYLNGYESPIPIREGGVLSGRIPA
GAHCVSLEHKTRGQKGETARNKRWRIGNFSLFFFCVDEVMEKVLGRCFNPPLTLSSQILY
TERFENKLDPDASSVNLIHCSHFESVNTSQTASEDQVPYTVSSMSQKNQGQQYEEVEKVW
LPNNSSRNSSPGLPDVAESQGRRSLIPYSDASLLPSVHTIILDFSMVHYVDSQGLVVLRQ
ICNAFRNANILILIAGCHFSIFCTGITLPDHITKCQQLSLNSLSRLPSFHLQHIF
Download sequence
Identical sequences ENSMMUP00000033803

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]