SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000033876 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000033876
Domain Number 1 Region: 260-290,329-407
Classification Level Classification E-value
Superfamily SpoIIaa-like 1.53e-16
Family Anti-sigma factor antagonist SpoIIaa 0.008
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000033876   Gene: ENSMMUG00000029776   Transcript: ENSMMUT00000040848
Sequence length 426
Comment pep:novel chromosome:MMUL_1:6:146459647:146460924:1 gene:ENSMMUG00000029776 transcript:ENSMMUT00000040848 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LVLLPTKELNEHFKSKLKAPIPIELVVVVAATLASHFGKLHENYNSSIAGHIPTGFMPPK
VPEWNLIPSVAVDAIAISIIGFAITVSLSEMFAKKHGYTVRANQEMYAIGFCNIIPSFFH
CFTTSAALAKTLVKESTGCQTQLSGVVTALVLLLVLLVIAPLFYSLQKSVLAVITIVNLR
GALRKFRDLPKMWNISRMDTVIWFVTMLSSALLSTEIGLLVGVCFSMFCVILRTQKPKSS
LLGLVEESEVFESVSAYKNLQTKPGIKIFRFVAPLYYINKECFKSALYKQTVNPILIKVA
WKKAAKRKIKEEVVTPGGIQDEMSVQLSHDPLELHTIVIDCSAIQFLDTAGIHTLKEVRR
DYEAIGIQVLLAQCNPSVRDSLTKGEYCKKEEENLLFYSVYEAMAFAEVSKNQKGIYVPN
GLNLSS
Download sequence
Identical sequences 9544.ENSMMUP00000033876 ENSMMUP00000033876 ENSMMUP00000033876

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]