SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000033884 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000033884
Domain Number 1 Region: 160-389
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 1.44e-57
Family Nuclear receptor ligand-binding domain 0.0000000122
Further Details:      
 
Domain Number 2 Region: 108-187
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 6.42e-30
Family Nuclear receptor 0.0000142
Further Details:      
 
Weak hits

Sequence:  ENSMMUP00000033884
Domain Number - Region: 81-121
Classification Level Classification E-value
Superfamily Hydrophobin II, HfbII 0.00863
Family Hydrophobin II, HfbII 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000033884   Gene: ENSMMUG00000003858   Transcript: ENSMMUT00000040856
Sequence length 390
Comment pep:known chromosome:MMUL_1:4:32909385:32914851:-1 gene:ENSMMUG00000003858 transcript:ENSMMUT00000040856 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPQGSVGRWGCEKKCIVGSRPGGGGDGPGWIPQRRRRRRRWQAENNKPRSRSRGRLDGTG
WATAGGINSTVSLPGGGSGPPEDVKPPVLGVRGLHCPPPPGGPGAGKRLCAICGDRSSGK
HYGVYSCEGCKGFFKRTIRKDLTYSCRDNKDCTVDKRQRNRCQYCRYQKCLATGMKREAV
QEERQRGKDKDGDGEGAGGAPEEMPVDRILEAELAVEQKSDQGVEGPGGTGGSGSSPNDP
VTNICQAADKQLFTLVEWAKRIPHFSSLPLDDQVILLRAGWNELLIASFSHRSIDVRDGI
LLATGLHVHRNSAHSAGVGAIFDRVLTELVSKMRDMRMDKTELGCLRAIILFNPDAKGLS
NPSEVEVLREKVYASLETYCKQKYPEQQGR
Download sequence
Identical sequences ENSMMUP00000033884

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]