SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000033887 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000033887
Domain Number 1 Region: 1-204
Classification Level Classification E-value
Superfamily Tubulin nucleotide-binding domain-like 1.44e-45
Family Tubulin, GTPase domain 0.000000104
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000033887   Gene: ENSMMUG00000021743   Transcript: ENSMMUT00000040859
Sequence length 211
Comment pep:novel chromosome:MMUL_1:7:13194525:13195241:-1 gene:ENSMMUG00000021743 transcript:ENSMMUT00000040859 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MREHISIHVGQAHGQIDNPCLELCCLEHGIQPDGQMPSDKTTGGDDSFDISETGAGKHTP
RAVFIDLESTFIDKVHIAIYHQLFYPEQLITGKEDIANKYAQGHYTIGKEIIGFMLDQIL
KLASWYTSLQGFLVFHSFVYSVSQVSTAVVEPYNSILTTHTTLQRSECAFVVDICHRNLN
IECSPYTNCLILQIMPSITASLRVDGSLNAD
Download sequence
Identical sequences ENSMMUP00000033887 ENSMMUP00000033887 9544.ENSMMUP00000033887

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]