SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000033984 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000033984
Domain Number 1 Region: 18-150
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 8.35e-44
Family Type II thymidine kinase 0.000000503
Further Details:      
 
Weak hits

Sequence:  ENSMMUP00000033984
Domain Number - Region: 204-230
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.000304
Family Type II thymidine kinase zinc finger 0.0047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000033984   Gene: ENSMMUG00000021867   Transcript: ENSMMUT00000040956
Sequence length 269
Comment pep:known chromosome:MMUL_1:16:73467284:73481887:-1 gene:ENSMMUG00000021867 transcript:ENSMMUT00000040956 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSCINLPTVLPGSPSKTRGQIQVILGPMFSGKSTELMRRVRRFQVAQYKCLVIKYAKDTR
YSSSFCTHDRNTMEALPACLLRDAAQEALGVAVIGIDEGQFFPDIVEFCEAMANAGKTVI
VAALDGTFQRKPFGTILNLVPLAESVVKLTAVCMECFREAAYTKRLGTEKEVAPPAFPAF
SAGRRGGGVALPPSCPGPSPVLCPCQVEVIGGADKYHSVCRLCYFKKASGQPAGPDNKEN
CPVPGKPGEAVAARKLFAPQQILQCSPAN
Download sequence
Identical sequences G7NH00 G7PSX6
ENSMMUP00000033984 ENSMMUP00000033984 9544.ENSMMUP00000033984

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]