SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000033994 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000033994
Domain Number 1 Region: 230-362
Classification Level Classification E-value
Superfamily Cadherin-like 5.63e-32
Family Cadherin 0.0011
Further Details:      
 
Domain Number 2 Region: 439-572
Classification Level Classification E-value
Superfamily Cadherin-like 5.8e-30
Family Cadherin 0.00088
Further Details:      
 
Domain Number 3 Region: 127-234
Classification Level Classification E-value
Superfamily Cadherin-like 1.44e-22
Family Cadherin 0.0048
Further Details:      
 
Domain Number 4 Region: 340-444
Classification Level Classification E-value
Superfamily Cadherin-like 7.71e-21
Family Cadherin 0.0033
Further Details:      
 
Domain Number 5 Region: 555-664
Classification Level Classification E-value
Superfamily Cadherin-like 5.1e-17
Family Cadherin 0.0038
Further Details:      
 
Domain Number 6 Region: 31-95
Classification Level Classification E-value
Superfamily Cadherin-like 0.00000457
Family Cadherin 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000033994   Gene: ENSMMUG00000021941   Transcript: ENSMMUT00000030872
Sequence length 787
Comment pep:known_by_projection chromosome:MMUL_1:6:137636886:137639656:1 gene:ENSMMUG00000021941 transcript:ENSMMUT00000030872 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEPTGERFPEQRQVLILLLLLEVALAGWEPRRYSVMEEAERGSFVANLANDLGLGVGELA
ERGARVVSEDNEQGLQLDLQTGQLILNEKLDREKLCGPTEPCIMHFQVLLKKPLEIFRAE
LLVRDINDHSPEFPEREMTLKIPETSSLGTVFPLKKARDLDVGSNNVQNYNISPNSHFHV
STRTQGDGRKYPELVLDTELDREEQAELRLTLTAVDGGSPPRSGTVQILILVLDVNDNAP
EFAQALYEVQVSENSPIGSLVVKVSARDLDTGPNGEISYSISYSSQEINEPFELSSLSGE
IRLIKKLDFETISSYDLDIEASDGGGLSGKCSVSVKVLDVNDNFPELSISSLTSPIPENS
PETEVALFRIRDRDSGENGKMICSIQDGVPFKLKPTVENFYRLVTEGALDRENRAQYNIT
ITITDLGTPRLKTEHCITVLVSDVNDNAPAFTQTSYTLFVRENNSPALHIGSVSATDRDS
GTNAQVTYSLLPPQDPHLPLASLVSINTDNGHLFALRSLDYETLQEFEFRVGATDRGSPE
LSSEALVRVLVLDANDNSPFVLYPLQNGSAPCTELVPRAAEPGYLVTKVVAVDGDSGQNA
WLSYQLLKATEPGLFRVWAHNGEVRTARLLSERDAAKHRLAVLVKDNGEPPLSATTTLHL
LLVDGFSQPYLPLPEAAPAQAQADSLTVYLVVALASVSSLFLLSVLLFVAVRLCRRSRAA
SVGRCSVPKGPFPGHLVDVSGTGTLSQSYQYEVCLTGGSESNDFKFLKPILPNILSQDSR
RKSEFLE
Download sequence
Identical sequences F6UY89
9544.ENSMMUP00000033994 XP_001092245.1.72884 ENSMMUP00000033994 ENSMMUP00000033994

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]