SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000033995 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000033995
Domain Number 1 Region: 230-361
Classification Level Classification E-value
Superfamily Cadherin-like 1.83e-30
Family Cadherin 0.0011
Further Details:      
 
Domain Number 2 Region: 439-572
Classification Level Classification E-value
Superfamily Cadherin-like 5.92e-29
Family Cadherin 0.0011
Further Details:      
 
Domain Number 3 Region: 127-234
Classification Level Classification E-value
Superfamily Cadherin-like 5.5e-22
Family Cadherin 0.01
Further Details:      
 
Domain Number 4 Region: 341-444
Classification Level Classification E-value
Superfamily Cadherin-like 2.88e-19
Family Cadherin 0.0047
Further Details:      
 
Domain Number 5 Region: 555-664
Classification Level Classification E-value
Superfamily Cadherin-like 3.53e-17
Family Cadherin 0.0039
Further Details:      
 
Domain Number 6 Region: 31-95
Classification Level Classification E-value
Superfamily Cadherin-like 0.000000842
Family Cadherin 0.0059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000033995   Gene: ENSMMUG00000029807   Transcript: ENSMMUT00000040965
Sequence length 797
Comment pep:known_by_projection chromosome:MMUL_1:6:137587560:137597509:1 gene:ENSMMUG00000029807 transcript:ENSMMUT00000040965 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEARGFSFPRQRQVLFLFLFWGVSLAGSGFRRYSVTEETDRGSFVVNLAKDLGLAEGELA
ARGTRVVSDDNKQYLLLDSHTGNLLTNEKLDREKLCGPKEPCMLYFQILMDDPFRIYRVE
LRVRDINDHSPVFQDKETVLKISENTAEGTAFRLERAQDPDGGPNGIQNYTISPNSFFHV
KIGGSDEGMIYPELVLDKALDREEQGELSLTLTALDGGSPPRSGTSTIGIVVLDVNDNAP
QFAQALYETQAPESSPIGFLIVKVSAEDIDSGVNAEVSYSFFDASENIRTTFQINPFSGE
IFLRELLDYELVNSYKINIQAMDGGGLSAICRVLVEVLDTNDNAPELIISSLSNSVAENS
PETVLAVFKINDRDSGENGKMVCYIQENLPFLLKPSVENFYILMTEGALDRESRAEYNIT
ITITDLGTPRLKTEHNITVLVSDVNDNAPAFIQTSYTLFVRENNSPALHIGSVSATDRDS
GTNAQVTYSLLPPQDPHLPLPSLVSINADNGHLFALRSLDYEALQAFEFRVGATDRGSPA
LSSEALVRVLVLDANDNSPFVLYPLQNGSAPCTELVPRAAEPGYLVTKVVAVDGDSGQNA
WLSYQLLKATEPGLFGVWAHNGEVRTARLLSERDATKHRLVVLVKDNGEPPRSATTTLQV
LLVDGFSQPYLPLPEAAPAQAQADSLTVYLVVALASVSSLFLLSVLLFVAVRLCRRSRAA
SVGRCSVPEGPFPGHLVDMSGTGTLSQSYQYEVCLTGGSGTNEFKFLKPIIPNIQAKGPG
KNSEENPTFRNSFEFNF
Download sequence
Identical sequences ENSMMUP00000033995 9544.ENSMMUP00000033995 ENSMMUP00000033995

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]