SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000033997 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000033997
Domain Number 1 Region: 230-354
Classification Level Classification E-value
Superfamily Cadherin-like 8.82e-32
Family Cadherin 0.001
Further Details:      
 
Domain Number 2 Region: 443-565
Classification Level Classification E-value
Superfamily Cadherin-like 1.57e-27
Family Cadherin 0.0029
Further Details:      
 
Domain Number 3 Region: 343-447
Classification Level Classification E-value
Superfamily Cadherin-like 1.96e-23
Family Cadherin 0.0027
Further Details:      
 
Domain Number 4 Region: 126-235
Classification Level Classification E-value
Superfamily Cadherin-like 4.84e-22
Family Cadherin 0.0026
Further Details:      
 
Domain Number 5 Region: 559-669
Classification Level Classification E-value
Superfamily Cadherin-like 8.57e-16
Family Cadherin 0.0021
Further Details:      
 
Domain Number 6 Region: 29-124
Classification Level Classification E-value
Superfamily Cadherin-like 0.0000000642
Family Cadherin 0.0077
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000033997   Gene: ENSMMUG00000014571   Transcript: ENSMMUT00000040969
Sequence length 950
Comment pep:known chromosome:MMUL_1:6:137287305:137410997:1 gene:ENSMMUG00000014571 transcript:ENSMMUT00000040969 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVFSWQGGPRQRQLLLWLLILTAWETSSGQLHYSVPEEAKHGTFVGRIAQDLGLELAELV
PRLFRVASKTHGDLLEVNLQNGILFVNSRIDREELCGRSAECSIHLEVIVDRPLQVFHVE
VKVRDINDNPPVFPESKKRITIAESRPPETRFPLDGASDADIGVNSALTYRLYPNDYFAL
DTQNSREQMSSLSLILRKTLDREEIQEHTLLLTASDGGKPELTGTVQLLITILDVNDNAP
EFYQSVYKVTMLENAFNGTLVIKLNATDPDDGTNGDIVYSFRRPVSPAVVYAFTINPNNG
EIRTKGKLDFEEKKLYEISVEAVDKGNIPMAGHCTLLVEVLDVNDNAPEVTITSLSLPIR
EDTQPSAIIALISVSDRDSGSNGQVTCTLTPHVPFKLVSTYKNYYSLVLDSALDRESVSA
YELVVTARDGGSPSLWATASVSVGVADVNDNAPAFAQSEYTVFVKENNPPGCHIFTVSAR
DADAQENALVSYSLVERRVGERALSSYVSVHAQSGKVYVLQPLDHEELELLQFQVSALDA
GVPPLGSNVTLQVFVLDENDNAPALLTPGAGSAGGTVSELVPRSVGAGHVVAKVRAVDAD
SGYNAWLSYELQPAAVGSRIPFRVGLYTGEISTTRSLDEVDARRHRLLVLVKDHGEPALT
ATATVLLSLVESGQQPKASSRASAGAVGQEAALVDVNVYLIIAICAVSSLLVLTLLLYTA
LRCSSPRTEGACALGKPTLVCSSAVGSWSYSQQRQQRVCSGEGPPKTDLMAFSPSLPPCL
ATVDANNNIDARIPHGLKPRQPNPDWRYSASLRAGMHSSVHLEEAGILRAGPGGPDQQWP
TVSSATPEPEAGEVSPPVGAGVNSNSWTFKYGPGNPKQSGPGELPDKFIIPGSPAIISIR
QEPTNNQIDKSDFITFGKKEETKKKKKKKKGNKTQEKKEKGNSTTDNSDQ
Download sequence
Identical sequences ENSMMUP00000033997

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]