SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000034042 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000034042
Domain Number 1 Region: 2-88
Classification Level Classification E-value
Superfamily Immunoglobulin 2.99e-19
Family I set domains 0.0065
Further Details:      
 
Domain Number 2 Region: 100-142
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000341
Family EGF-type module 0.0077
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000034042   Gene: ENSMMUG00000010301   Transcript: ENSMMUT00000041010
Sequence length 602
Comment pep:known_by_projection chromosome:MMUL_1:6:136258951:136456651:-1 gene:ENSMMUG00000010301 transcript:ENSMMUT00000041010 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKSQTGQVGEKQSLKCEAAAGNPQPSYRWFKDGKELNRSRDIRIKYGNGRKNSRLQFNKV
KVEDAGEYVCEAENILGKDTVRGRLYVNSVSTTLSSWSGHARKCNETAKSYCVNGGVCYY
IEGINQLSCKCPNGFFGQRCLEKLPLRLYMPDPKQSIINYSVREAEELYQKRVLTITGIC
VALLVVGIVCVVAYCKTKKQRKQMHNHLRQNMCPAHQNRSLANGPSHPRLDPEEIQMADV
TTDHVIRRETETFSGSHSCSPSHHCSTATPTSSHRHESHTWSLERSESLTSDSQSGIMLS
SVGTSKCNSPACVEARARRAAAYNLEERRRATVPPYHDSVDSLRDSPHSERSVPTPWPMP
SPLSQRAGTTGPRLTLRAPQKHSEEVGPVDPVTLEHQEQTGSWVWWLTPVIPALWEAKAD
GSLEVRSDYYYYPAAGPGPRRGTCALGGSLGSLPATPFRIPEDDEYETTQECAPPPPRPR
ARGASRRTSAGPRRWRRSRLNGLAAQRARAARDSLSLSSGSGGGSASASDDDADDADGAL
AAESTPFLGLRAAHDALRSDSPPLCPAADSRTYYSLDSHSTRASSRHSRGPPPRAKQDSA
PL
Download sequence
Identical sequences ENSMMUP00000034042

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]