SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000034160 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000034160
Domain Number 1 Region: 3-130
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 1.24e-36
Family Eukaryotic proteases 0.00046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000034160   Gene: ENSMMUG00000029850   Transcript: ENSMMUT00000041124
Sequence length 131
Comment pep:novel scaffold:MMUL_1:1099214760817:398:1284:1 gene:ENSMMUG00000029850 transcript:ENSMMUT00000041124 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MENELFCSGVLVHPQWVLSAAHCFQKSYTIGLGLHSLEADQEPGSRMVEASYSVQHPEYN
RPLLANDLMLIKLDESVSESATIRNISLASRCPTAGDSCLVSGWGLLANGRTPTVLQCVN
LSVVSEEVCSE
Download sequence
Identical sequences ENSMMUP00000031498 ENSMMUP00000034160 9544.ENSMMUP00000031498 9544.ENSMMUP00000034160 ENSMMUP00000031498 ENSMMUP00000034160

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]