SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000034339 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000034339
Domain Number 1 Region: 197-240
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.0000222
Family Eukaryotic type KH-domain (KH-domain type I) 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000034339   Gene: ENSMMUG00000029934   Transcript: ENSMMUT00000041307
Sequence length 269
Comment pep:known_by_projection chromosome:MMUL_1:6:88095021:88095854:-1 gene:ENSMMUG00000029934 transcript:ENSMMUT00000041307 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
NRPERVITLAGLTNAIFKGFMIIDKLEEDISSCITNSTGASRPLVPNQCDPLIGKGGCKI
KERECRGSGAADRGYAPNSTEWAITIANILQSIIECVKQTCIVMLELSQYPRKGMTIPYQ
PKPLLSSLVIFAGGKDRYITSSNSASFPHTTLSMCFNAYLEGSPLELTKLHQWAMQQAYF
PMIHGDTGFSAGLNASAPTTSHELTIPNHLIGHQGTQIKEIPPKCGVQIKILNPVEGSTD
SRRSAASISLVQYLINVRLSSETGGMRSS
Download sequence
Identical sequences ENSMMUP00000034339 9544.ENSMMUP00000034339 ENSMMUP00000034339

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]