SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000034394 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000034394
Domain Number 1 Region: 271-416
Classification Level Classification E-value
Superfamily ThrRS/AlaRS common domain 6.28e-32
Family AlaX-like 0.028
Further Details:      
 
Domain Number 2 Region: 47-172
Classification Level Classification E-value
Superfamily HSP20-like chaperones 7.33e-28
Family Co-chaperone p23-like 0.0001
Further Details:      
 
Domain Number 3 Region: 212-268
Classification Level Classification E-value
Superfamily Translation proteins 0.000000000388
Family AlaX-M N-terminal domain-like 0.0035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000034394   Gene: ENSMMUG00000014123   Transcript: ENSMMUT00000041366
Sequence length 585
Comment pep:novel chromosome:MMUL_1:16:53078130:53106517:-1 gene:ENSMMUG00000014123 transcript:ENSMMUT00000041366 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFSVPLNCFPDHIRGGSCWGRPQDLKIAAPAWNSKCHPGAGAAMARQHARTLWYDRPKYV
FMEFCVEDSTDVHVLIEDHRIVFSCKNDDGVELYNEIEFYAKVNSKDSQDKRSSRSITCF
VRKWKEKVAWPRLTKEDIKPVWLSVDFDNWRDWEGDEEVELAQVEHYAELLQKVSTKRPP
PAMDDLDFTTTVVSCRPAELQTEGSNGKKVLSGFHVVLEDTLLFPEGGGQPDDHGTINDI
SVLRVTRRGEQADHFTQTPLDPGSQVLVRVDWERRFDHMQQHSGQHLITAVADHLFKLKT
TSWELGRFRSAIELDTPSMTTEQVAAIEQSVNEKIRDRLPVNVRELSLDDPEVEQVRGRG
LPDDHAGPVRVVSIKGVDSNMCCGTHVSNLSDLQVIKILGTEKGKKNKTNLIFLAGNRVL
KWMERSHGTEKALTALLKCGAEDHVEAVKKLQNSTKILQKNNLNLLRDLAVHIAHSLRNS
PDWGGVVVLHRKEGDSEFMNIIANEIGSEETLLFLTVGDEKGAGLFLLAGPPASVETLGP
RVAEVLEGKGAGKKGRFQGKATKMSRRTEVQALLQDYITTQSTKE
Download sequence
Identical sequences F6PQH0
ENSMMUP00000018557 9544.ENSMMUP00000034394 ENSMMUP00000034394

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]