SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000034440 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000034440
Domain Number 1 Region: 2445-2645
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 6.97e-37
Family Laminin G-like module 0.003
Further Details:      
 
Domain Number 2 Region: 1962-2073
Classification Level Classification E-value
Superfamily Cadherin-like 4.43e-32
Family Cadherin 0.0011
Further Details:      
 
Domain Number 3 Region: 1856-1961
Classification Level Classification E-value
Superfamily Cadherin-like 1.23e-30
Family Cadherin 0.0018
Further Details:      
 
Domain Number 4 Region: 904-1020
Classification Level Classification E-value
Superfamily Cadherin-like 1.03e-29
Family Cadherin 0.00076
Further Details:      
 
Domain Number 5 Region: 1752-1855
Classification Level Classification E-value
Superfamily Cadherin-like 7.14e-29
Family Cadherin 0.00044
Further Details:      
 
Domain Number 6 Region: 1436-1544
Classification Level Classification E-value
Superfamily Cadherin-like 4.45e-28
Family Cadherin 0.0011
Further Details:      
 
Domain Number 7 Region: 189-291
Classification Level Classification E-value
Superfamily Cadherin-like 3.66e-27
Family Cadherin 0.0013
Further Details:      
 
Domain Number 8 Region: 1650-1758
Classification Level Classification E-value
Superfamily Cadherin-like 1.7e-26
Family Cadherin 0.001
Further Details:      
 
Domain Number 9 Region: 392-512
Classification Level Classification E-value
Superfamily Cadherin-like 1.57e-25
Family Cadherin 0.0017
Further Details:      
 
Domain Number 10 Region: 702-809
Classification Level Classification E-value
Superfamily Cadherin-like 7.71e-24
Family Cadherin 0.0024
Further Details:      
 
Domain Number 11 Region: 1545-1656
Classification Level Classification E-value
Superfamily Cadherin-like 1.43e-22
Family Cadherin 0.0025
Further Details:      
 
Domain Number 12 Region: 809-916
Classification Level Classification E-value
Superfamily Cadherin-like 1.7e-21
Family Cadherin 0.0015
Further Details:      
 
Domain Number 13 Region: 83-187
Classification Level Classification E-value
Superfamily Cadherin-like 1.83e-21
Family Cadherin 0.0016
Further Details:      
 
Domain Number 14 Region: 2066-2170
Classification Level Classification E-value
Superfamily Cadherin-like 2.86e-21
Family Cadherin 0.0012
Further Details:      
 
Domain Number 15 Region: 1016-1116
Classification Level Classification E-value
Superfamily Cadherin-like 7.14e-21
Family Cadherin 0.0031
Further Details:      
 
Domain Number 16 Region: 1217-1328
Classification Level Classification E-value
Superfamily Cadherin-like 3.57e-20
Family Cadherin 0.0011
Further Details:      
 
Domain Number 17 Region: 295-398
Classification Level Classification E-value
Superfamily Cadherin-like 1.71e-19
Family Cadherin 0.0022
Further Details:      
 
Domain Number 18 Region: 1119-1229
Classification Level Classification E-value
Superfamily Cadherin-like 3.71e-19
Family Cadherin 0.0018
Further Details:      
 
Domain Number 19 Region: 505-602
Classification Level Classification E-value
Superfamily Cadherin-like 2.22e-16
Family Cadherin 0.0045
Further Details:      
 
Domain Number 20 Region: 17-89
Classification Level Classification E-value
Superfamily Cadherin-like 5.37e-16
Family Cadherin 0.0075
Further Details:      
 
Domain Number 21 Region: 611-714
Classification Level Classification E-value
Superfamily Cadherin-like 0.00000000000000385
Family Cadherin 0.0017
Further Details:      
 
Domain Number 22 Region: 1336-1434
Classification Level Classification E-value
Superfamily Cadherin-like 0.000000000000528
Family Cadherin 0.0044
Further Details:      
 
Domain Number 23 Region: 2175-2264
Classification Level Classification E-value
Superfamily Cadherin-like 0.00000000271
Family Cadherin 0.0087
Further Details:      
 
Domain Number 24 Region: 2760-2798
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000028
Family EGF-type module 0.0055
Further Details:      
 
Domain Number 25 Region: 2672-2800
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000235
Family Growth factor receptor domain 0.018
Further Details:      
 
Weak hits

Sequence:  ENSMMUP00000034440
Domain Number - Region: 2647-2683
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00163
Family EGF-type module 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000034440   Gene: ENSMMUG00000018051   Transcript: ENSMMUT00000041413
Sequence length 3233
Comment pep:known_by_projection chromosome:MMUL_1:5:178698598:178838809:-1 gene:ENSMMUG00000018051 transcript:ENSMMUT00000041413 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MESDPVAHMIGVISVEPPGIPLWFDITGGNYDSHFDVDKGTGTIIVAKPLDAEQKSNYNL
TVEATDGTTTILTQVFIKVIDTNDHRPQFSTSKYEVVIPEDTVPETEILHISAVDQDEKN
RLIYTLQGSRDPLSLKKFRLDPATGSLYTSEKLDHEAVHQHTLTVMVRDQDVPVKRNFAR
IVVNVSDTNDHAPWFTASSYKGRVYESAAVGSVVLQVTALDKDKGKNAEVLYSIESGNIG
NSFMIDPVLGSIKTAKELDRSNQVEYDLIVKATDKGSPPMSEVTSVHIFVTVADNAPPKF
TSKDYSVEISETVSIGSFVGMVTAHSQSSVVYEIKDGNTGDAFDINPHSGSIITQKALDF
ETLPVYTLIIQGTNMAGLSTNTTVSVQLQDENDNSPVFMQAEYTGLISESASINSVVLTD
RNVPLVIRAADADKDSNALLVYHIVEPSVHKYFAIDSSTGAIHTVLSLDYEETSTFHFTV
QVHDMGTPRLFAEYAANVTIHVIDINDCPPVFAKPLYEACLLLPTYKGVKVITVNATDAD
SSAFSQLIYSITEGNIGEKFSMDYKTGALTVQNTTQLRSRYELTVRASDGRFAGLTSVKI
NVKESKESHLKFTQDVYSAVVKENSTEAKTLAVITAIGNPINEPLFYHILNPDRRFKISR
TSGVLSTTGIPFDREQQEAFDVVVEVTEEHKPSAVAHVVVKVIVEDQNDNAPVFVNLPYY
AVVKVDTEVGRVIRHVTAVDRDSGRNGEVHYYLKEHHEYFQIGPLGEISLKKQFELDTLN
KEYLVTVVAKDGGNPAFSAEVMVPITVMNKAMPVFEKPFYSAEIAENVQVHSPVVHVQAN
SPEGLKVFYSITDGDPFSQFTINFNTGVINVIAPLDFEAHPAYKLSIRATDSLTGAHAEV
FVDIIVEDINDNAPVFAQQSYAATLSEASVIGTSVVQVRATDSDSEPNRGISYQLFGNLS
KSHDHFHVDSSTGLISLLRTLDYEQSQRHTIFVRAVDGGMPPLSSDVIVTVDVTDLNDNP
PLFEQQIYEARISEHAPHGHFVTCVKAYDADSSDIDKLQYSILSGNDHKHFIIDSATGII
TLSNLRRHTLKPFYSLNLSVSDGVFRSSTQVHVTVIGGNLHSPAFLQNEYEVELAENAPL
HTLVMEVKTTDGDSGIYGDVTYHIVNDFAKDRFYVNERGQIFTLEKLDRETPAEKVISVR
LMAKDAGGKVAFCTVNVILTDDNDNAPQFRATKYEVNIGSSAAKGTSVIKVLASDADEGS
NADVTYAIEADSDSVKENLEINKLSGVITTKESLIGLENEFFTFFVRAVDNGSPSKESVV
PVYVKILPPETQLPKFSEPFYTYTVSEDVPIGTEIDLIRAEHSGTVLYSLVKGNTPESNR
DESFVIDRQSGRLKLEKSLDHEITKWYQFSILARCTQDDREMVASVDVSIQVKDANDNSP
VFESSPYEAFIVENLPGGSRVIQIRASDADSGTNSQVMYSLDQSQSVEVIESFAINMETG
WITTLKELDHEERDNYQIKVVASDHGEKIQLSSTAIVDVTVTDVNDSPPRFTAEIYKGTV
SEDDPPGGVIAILSTTDADSEEINRQVTYFITGGDPLGQFAVENIQNEWKVYVKKPLDRE
KRDNYLLTITATDGTFSSKAIVEVKVLDANDNSPVCEKTLYSDTIPEDVLPGKLIMQISA
ADADIRSNAEITYTLSGSGAEKFQLNPDTGELKTSAPLDREEQAVYHLLVRATDRGGRFC
QASIVLTLEDVNDNAPEFSADPYAITVFENTEPGTLLTRVQATDADSGLNRKILYSLIDS
ADGQFSINELSGIIQLEKPLDRELQAVYTLSLKAVDQGLPRRLTATGTVVVSVLDINDNP
PVFEYREYGATVSEDILVGTEVLQVYAASRDIEANAEITYSIISGNEHGKFSIDSKTGAV
FIIENLDYESSHEYYLTIEATDGGTPSLSDVATVNVNVTDVNDNAPVFSQDTYTAVVSED
AVLEQSVITVLADDADGPSNSHIHYSIIDGNQGGPFTIDPVRGEVKVTKLLDRETISGYT
LTVQASDNGSPPRVNTTAVNIDVSDVNDNAPVFSRGNYSVIIQENKPVGFSVLRLVVTDE
DSSHNGPPFVFTIVTGNDEKAFEVNQQGVLLTASAIKRKEKDHFLLQVKVADNGKPQLSS
LTYIDIRVIEESIYPPAILPLEIFITASGEEYSGGVIGKIHATDQDVYDTLTYSLDPQMD
NLFSVSSTGGKLIAHKKLDIGQYLLNVSVTDGKFTTVADITVHIRQVTQEMLNHTIAIRF
ANLTPEEFVGDYWRNFQRALRNILGVRRSDIHIVSLQPSEPHPHLDVLLFVEKSGGAQIS
TKQLLHKINSSVTDIEDIIGVRILDVFQKLCAGLDCPWKFCDEKVSVDESVMSTHSTARL
SFVTPRHHRAAVCLCKEGRCPAVHHGCEDHPCPEGSECVSDPREEKHTCVCPGGRFAQCP
GSSSMTLTGNSYVKYRLTENENKLEMKLTMRLRTYSMHAVVMYARGTDYSILEIHNGRLQ
YKFDCGSGPGIVSVQSIQVNDGQWHAVSLEVNGNYARLVLDQVHTASGTAPGTLKTLNLD
NYVFFGGHIRQQGTRHGRSPQVANGFRGCMDSIYLNGQELPFNSKPRSYAHMEESVGVSP
GCFLTATEDCASGPCQNGGICSPSPAGGYYCKCSALYIGTYCEISVNPCSSNPCLYGGTC
VVDNGGFVCQCRGLYTGQRCQLSPYCKDDPCKNGGTCFDSLDGAVCQCDSGFRGERCQSD
IDECAGNPCRHGALCENTHGSYHCNCSHEYRGRHCEDAAPNQYVSTPWNIGLAEGIGIIV
FIAGIFLLVVVFVLCRKMMSRKKKHQAEPEDKHLGPTTAFLQRPYFDSKLNKNIYSDVPP
QVPVRPISYTPSIPSDSRNNLDRNSFEGSAIPEHPEFSTFNPESVHGHRKAVAVCSVAPN
LPPPPPSNSPSDSDSIQKPSWDFDYDTKVVDLDPCLSKKPLEEKPSQPYSARESLSEVQS
LSSFQSESCDDNESLAAPDLSKPRGYHWDTSDWMPSVPLPDIQEFPNYEVIDEQTPLYSG
DPNAIDTDYYPGGYDIESDFPPPPEDFPAADELPPLPPEFGDQFESIHPPRDMPAAGSLG
SSSRNRQRFTLNQYLPNFYPLDMSEPQTKGTGENSTCRESHAPYPPGYQRHLEVPTVESV
PMSVYASTASCSDVSACCEVESEVMMSDYESGDDGHFEEVAIPPLDSQQHTEV
Download sequence
Identical sequences ENSMMUP00000034440

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]