SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000034496 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000034496
Domain Number 1 Region: 140-237
Classification Level Classification E-value
Superfamily Thioredoxin-like 1.91e-27
Family Thioltransferase 0.0000149
Further Details:      
 
Domain Number 2 Region: 6-92
Classification Level Classification E-value
Superfamily Thioredoxin-like 1.66e-19
Family Thioltransferase 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000034496   Gene: ENSMMUG00000017756   Transcript: ENSMMUT00000041467
Sequence length 239
Comment pep:novel chromosome:MMUL_1:4:3838325:3839288:1 gene:ENSMMUG00000017756 transcript:ENSMMUT00000041467 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
AAAAAVEEVSSAGQFEELLHLKAKSLFVAHFWAPQVPQCAQMNEVMAELAKEHPQVSFVK
LEAECPEVSEKYEISSVPTVLFFNNSQKNGAHVPELTKKVQRHACSGSFPASTDEHLKAD
RNELQTSEELDTICPKAPKLEERLKVLTNKASVMLFMKGNKQEAKCGFSKQILEILNRTG
VECETFDILEDKGVQQGLKAYSNWPAYPQLYVKGELVGRLDIVKELKENGELLPILRGE
Download sequence
Identical sequences ENSMMUP00000034496 ENSMMUP00000023354 9544.ENSMMUP00000034496

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]