SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000034571 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000034571
Domain Number 1 Region: 151-346
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 7.58e-60
Family Astacin 0.0000675
Further Details:      
 
Domain Number 2 Region: 778-885
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 4.84e-38
Family Spermadhesin, CUB domain 0.00022
Further Details:      
 
Domain Number 3 Region: 467-571
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 7.07e-38
Family Spermadhesin, CUB domain 0.00021
Further Details:      
 
Domain Number 4 Region: 618-728
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 9.03e-36
Family Spermadhesin, CUB domain 0.00023
Further Details:      
 
Domain Number 5 Region: 353-462
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.44e-35
Family Spermadhesin, CUB domain 0.00048
Further Details:      
 
Domain Number 6 Region: 909-1002
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 3.4e-27
Family Spermadhesin, CUB domain 0.00046
Further Details:      
 
Domain Number 7 Region: 729-771
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000599
Family EGF-type module 0.0083
Further Details:      
 
Domain Number 8 Region: 574-616
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000965
Family EGF-type module 0.0061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000034571   Gene: ENSMMUG00000015799   Transcript: ENSMMUT00000041543
Sequence length 1013
Comment pep:known_by_projection chromosome:MMUL_1:5:158054066:158277874:1 gene:ENSMMUG00000015799 transcript:ENSMMUT00000041543 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGLEKLSLRMLVWLVASGIVFYGELWVCAGLDYDYTFDGNEEDKTETIDYKDPCKAAVFW
GDIALDDEDLSIFQIDRTIDLTQNPFGNLGHTTGGLGDHAMSKKRGALYQLIDRIRRIGF
GLEQNNTVKGKVPLQFSGQNEKNRVPRAATSRTERIWPGGVIPYVIGGNFTGSQRAMFKQ
AMRHWEKHTCVTFIERSDEESYIVFTYRPCGCCSYVGRRGNGPQAISIGKNCDKFGIVVH
ELGHVIGFWHEHTRPDRDNHVTIIRENIQPGQEYNFLKMEPGEVNSLGERYDFDSIMHYA
RNTFSRGMFLDTILPSRDDNGIRPAIGQRTRLSKGDIAQARKLYRCPACGETLQESNGNL
SSPGFPNGYPSYTHCIWRVSVTPGEKIVLNFTTMDLYKSSLCWYDYIEVRDGYWRKSPLL
GRFCGDKVPEVLTSTDSRMWIEFRSSSNWVGKGFAAVFKAICGGEIRKNEGQIQSPNYPD
DYRPMKECVWKITVSEGYHVGLTFQSFEIERHDNCAYDYLEVRDGTSENSPLIGRFCGYD
KPEDIRSTSNTLWMKFVSDGTVNKAGFAANFFKEEDECAKPDRGGCEQRCLNTLGSYQCA
CEPGYELGPDRRSCEAACGGLLTKLNGTITTPGWPKEYPPNKNCVWQVVAPTQYRISVKF
EFFELEGNEVCKYDYVEIWSGLSSDSKLHGKFCGAEVPEVITSQFNNMRIEFKSDNTVSK
KGFKAHFFSDKDECSKDNGGCQHECVNTMGSYMCQCRNGFVLHENKHDCKEAECEQKIHS
PSGLITSPNWPDKYPSRKECTWEISATPGHRIKLAFSEFEIEQHQECAYDHLEVFDGETE
KSPILGRLCGNKIPDPLVATGNKMFVRFVSDASVQRKGFQATHSTECGGRLKAESKPRDL
YSHAQFGDNNYPGQVDCEWLLVSERGSRLELSFQTFEVEEEADCGYDYVELFDGLDSTAV
GLGRFCGSGPPEEIYSIGDAVLIHFHTDDTINKKGFHIRYKSIRYPDTTHTKK
Download sequence
Identical sequences ENSMMUP00000020759 9544.ENSMMUP00000034571 ENSMMUP00000034571

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]