SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000034614 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000034614
Domain Number 1 Region: 96-192
Classification Level Classification E-value
Superfamily Ubiquitin-like 1.51e-31
Family Ras-binding domain, RBD 0.00000432
Further Details:      
 
Domain Number 2 Region: 419-529
Classification Level Classification E-value
Superfamily SH2 domain 8.75e-31
Family SH2 domain 0.000000512
Further Details:      
 
Domain Number 3 Region: 230-342
Classification Level Classification E-value
Superfamily PH domain-like 0.0000000000000023
Family Pleckstrin-homology domain (PH domain) 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000034614   Gene: ENSMMUG00000020775   Transcript: ENSMMUT00000041588
Sequence length 532
Comment pep:known chromosome:MMUL_1:16:49838663:49847117:1 gene:ENSMMUG00000020775 transcript:ENSMMUT00000041588 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MELDLSPPHLGSSPEDLCPAPGTPPGTPRPPDTPLPEEVKRSQPLLIPTTGRKLREEERR
ATSLPSIPNPFPELCSPPSQSPILGGPSSARGLLPRDASRPHVVKVYSEDGACRSVEVAA
GATARHVCEMLVQRAHALSDETWGLVECHPHLALERGLEDHESVVEVQAAWPVGGDSRFV
FRKNFAKYELFKSSPHSLFPEKMVSSCLDAHTGISHEDLIQNFLNAGSFPEIQGFLQLRG
SGRKLWKRFFCFLRRSGLYYSTKGTSKDPRHLQYVADVNESNVYVVTQGRKLYGMPTDFG
FCVKPNKLRNGHKGLRIFCSEDEQSRTCWLAAFRLFKYGVQLYRNYQQAQSRHLRPPCLG
SPPLRSVSDNTLVAMDFSGHAGRVIENPREALSVALEEAHAWRKKTNHRLSLPTPASGTS
LSAAIHRTQLWFHGRISREESQRLIGQQGLVDGLFLVRESQRNPQGFVLSLCHLQKVKHY
LILPSEEEGRLYFSMDDGQTRFTDLLQLVEFHQLNRGILPCLLRHCCTRVAL
Download sequence
Identical sequences A0A0D9S379 A0A2K5U3C5 A0A2K6CEF6 F7HC81
9544.ENSMMUP00000034614 XP_005584095.1.63531 XP_005584096.1.63531 XP_008011029.1.81039 XP_008011031.1.81039 XP_008011032.1.81039 XP_008011033.1.81039 XP_011723599.1.29376 XP_011723600.1.29376 XP_011723601.1.29376 XP_014975027.1.72884 XP_014975028.1.72884 XP_014975029.1.72884 XP_014975030.1.72884 XP_015293388.1.63531 ENSMMUP00000027343 ENSMMUP00000027343 ENSMMUP00000027345 ENSMMUP00000034614

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]