SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000034656 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000034656
Domain Number 1 Region: 88-224
Classification Level Classification E-value
Superfamily Fibrinogen coiled-coil and central regions 1.78e-65
Family Fibrinogen coiled-coil and central regions 0.0000156
Further Details:      
 
Domain Number 2 Region: 226-314
Classification Level Classification E-value
Superfamily Fibrinogen C-terminal domain-like 5.36e-31
Family Fibrinogen C-terminal domain-like 0.00000361
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000034656   Gene: ENSMMUG00000021302   Transcript: ENSMMUT00000041630
Sequence length 320
Comment pep:known_by_projection chromosome:MMUL_1:5:146764138:146771927:1 gene:ENSMMUG00000021302 transcript:ENSMMUT00000041630 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKRMVSWSFHKFKTMKHLLLLLLCVFLVKSQGVNGNEESPFSGRGHRPLDKKREEAPSLR
PAPPPISGGGYRARPAKAAASQKKVERKAPDAGGCLHADPDLGVLCPTGCQLQEALLQQE
RPIRSSVDELKNSVQIVSQTSSSTFQYTYLLKDMWQKRQKQVKDNENVVNEYSSDLEKHQ
LYIDETVNSNIPTNLRVLRSILENLRSKIQKLESDVSAQMEYCRTPCTVSCNIPVVSGKE
CEEIIRKGGETSEMYLIQPDSSVKPYRVYCDMNTENGGWTVIQNRQDGSVDFGRKWNPYK
QGFGNIATNTDGKNYCGLPG
Download sequence
Identical sequences ENSMMUP00000034656

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]