SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000034710 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000034710
Domain Number 1 Region: 168-239
Classification Level Classification E-value
Superfamily Homeodomain-like 1.33e-20
Family Homeodomain 0.0014
Further Details:      
 
Domain Number 2 Region: 30-95
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.00000000000000524
Family LIM domain 0.009
Further Details:      
 
Domain Number 3 Region: 2-29
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.0000000404
Family LIM domain 0.022
Further Details:      
 
Weak hits

Sequence:  ENSMMUP00000034710
Domain Number - Region: 91-120
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.0344
Family LIM domain 0.039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000034710   Gene: ENSMMUG00000021668   Transcript: ENSMMUT00000041689
Sequence length 375
Comment pep:known_by_projection chromosome:MMUL_1:16:46926234:46931859:1 gene:ENSMMUG00000021668 transcript:ENSMMUT00000041689 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVHCAGCKRPILDRFLLNVLDRAWHVKCVQCCECKCNLTEKCFSREGKLYCKNDFFRCFG
TKCAGCAQGISPSDLVRRARSKVFHLNCFTCMMCNKQLSTGEELYIIDENKFVCKEDYLS
NSSVAKENSLHSATTGSDPSLSPDSQDPSQDDAKDSESANVSDKEGGSNENDDQNLGAKR
RGPRTTIKAKQLETLKAAFAATPKPTRHIREQLAQETGLNMRVIQVWFQNRRSKERRMKQ
LSALGARRHAFFRSPRRMRPLVDRLEPGELIPNGPFSFYGDYQSEYYGPGGNYDFFPQGP
PSSQAQTPVDLPFVPSSGPSGTPLGGLEHPLPGHHPSSEAQRFTDILAHPPGRLAQPRAQ
PARASALHVGRGLWA
Download sequence
Identical sequences 9544.ENSMMUP00000034710 ENSMMUP00000034710 ENSMMUP00000028533

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]