SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000034794 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000034794
Domain Number 1 Region: 236-342
Classification Level Classification E-value
Superfamily Cadherin-like 1.83e-29
Family Cadherin 0.00091
Further Details:      
 
Domain Number 2 Region: 443-567
Classification Level Classification E-value
Superfamily Cadherin-like 1.31e-27
Family Cadherin 0.00095
Further Details:      
 
Domain Number 3 Region: 344-447
Classification Level Classification E-value
Superfamily Cadherin-like 3.4e-24
Family Cadherin 0.0019
Further Details:      
 
Domain Number 4 Region: 560-672
Classification Level Classification E-value
Superfamily Cadherin-like 7.33e-21
Family Cadherin 0.002
Further Details:      
 
Domain Number 5 Region: 127-234
Classification Level Classification E-value
Superfamily Cadherin-like 6.67e-20
Family Cadherin 0.0073
Further Details:      
 
Domain Number 6 Region: 29-125
Classification Level Classification E-value
Superfamily Cadherin-like 0.000000011
Family Cadherin 0.0068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000034794   Gene: ENSMMUG00000023149   Transcript: ENSMMUT00000041779
Sequence length 718
Comment pep:novel chromosome:MMUL_1:5:125459333:125462403:1 gene:ENSMMUG00000023149 transcript:ENSMMUT00000041779 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RSSETASPDHKMIVLLFFALLWMVEGVFSQLHYTVQEEQEHGTFVGNIAEDLGLDITKLS
ARGFQTVPNSRTPYLDLNLETGVLYVNEKIDREQICKQSPSCVLHLEVFLENPLELFQVE
IEVLDINDNPPSFPEPDLTVEISESATPGTRFPLESAFDPDVGTNSLRDYEITPNSYFSL
DVQTQGDGNRFAELVLEKPLDREQQAVHRYVLTAVVPPQQQRTGTALLTIRVLDSNDNVP
AFDQPVYTVSLPENSPPGTLVIQLNATDPDEGQNGEVVYSFSSHISPRARELFGLSPRTG
RLEVSGELDYEESPVYQVYVQAKDLGPNAVPAHCKVLVRVLDANDNAPEISFSTVKEAVS
EGAAPGTVVALFSVTDRDSEENGQVQCELLGDVPFRLKSSFKNYYTIVTEAPLDREAGDS
YTLTVVARDRGEPALSTSKSIQVQVSDVNDNAPRFSQPVYDVYVTENNVPGAYIYAVSAT
DRDEGANAQLAYSILECQIQGMSVFTYVSINSENGYLYALRSFDYEQLKDFSFQVEARDA
GSPQALAGNATVNILIVDQNDNAPAIVAPLPGRNGTPAREVLPRSAEPGYLLTRVAAVDA
DDGENARLTYSIVRGNEMNLFRMDWRTGELRTARRVPAKRDPQRPYELVIEVRDHGQPPL
SSTATLVVQLVDGAVEPQAGAGAEAEGGGETSLDLTLILIIALGSVSFIFLLAMIVLV
Download sequence
Identical sequences ENSMMUP00000034794

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]