SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000034892 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000034892
Domain Number 1 Region: 26-127
Classification Level Classification E-value
Superfamily Cadherin-like 0.0000000000392
Family Dystroglycan, N-terminal domain 0.03
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000034892   Gene: ENSMMUG00000001466   Transcript: ENSMMUT00000041881
Sequence length 263
Comment pep:known_by_projection chromosome:MMUL_1:16:34402786:34414593:1 gene:ENSMMUG00000001466 transcript:ENSMMUT00000041881 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAVTLFWTPLLVVLLAGLGDCEAQQTTLYPLVGRVFVHTLDHETFLSLPEHVAVPPAVHI
TYHAHLQGHPDLPRWLRYTQRSPHHPGFLYGSATPEDRGRQVIEVTAYNRDSFDTTQQRL
VLEIGDSEGPLLPYQAEFLVRSHDVEEVLPSAPASRFLSALGGLWEPGELQLLNITSALD
RGGRVPLPIEGRKEGLKRDLATSDIQMVHHCTIHGNTEELRQMAANREVPRPLSTLPMFN
VRTGERLPPRVDSAQVPLILDQH
Download sequence
Identical sequences A0A2K5UMY6 F7H4B9
ENSMMUP00000034892

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]