SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000034906 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000034906
Domain Number 1 Region: 28-133
Classification Level Classification E-value
Superfamily Cadherin-like 9.99e-19
Family Cadherin 0.0015
Further Details:      
 
Weak hits

Sequence:  ENSMMUP00000034906
Domain Number - Region: 8-35
Classification Level Classification E-value
Superfamily Cadherin-like 0.0561
Family Cadherin 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000034906   Gene: ENSMMUG00000012293   Transcript: ENSMMUT00000041896
Sequence length 334
Comment pep:known chromosome:MMUL_1:6:24502002:24514197:-1 gene:ENSMMUG00000012293 transcript:ENSMMUT00000041896 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLLISAFVAKDNPKETTRVAVFVRILDVNDNAPQFAVFYDTFVCENARPGQLIQTISAVD
KDDPLGGQKFFFSLAAVNPNFTVQDNEDNTARILTRKNGFNRHEISTYLLPVVISDNDYP
IQSSTGTLTIRVCACDSQGNMQSCSAEALLLPAGLSTGALIAILLCIIILLVIVVLFAAL
KRQRKKEPLILSKEDIRDNIVSYNDEGGGEEDTQAFDIGTLRNPAAIEEKKLRRDIIPET
LFIPRRTPTAPDNTDVRDFINERLKEHDLDPTAPPYDSLATYAYEGNDSIAESLSSLESG
TTEGDQNYDYLREWGPRFNKLAEMYGGGESDKDS
Download sequence
Identical sequences ENSMMUP00000034906

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]