SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000034911 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000034911
Domain Number 1 Region: 149-271
Classification Level Classification E-value
Superfamily Cadherin-like 6.85e-26
Family Cadherin 0.0015
Further Details:      
 
Domain Number 2 Region: 38-154
Classification Level Classification E-value
Superfamily Cadherin-like 4e-25
Family Cadherin 0.00085
Further Details:      
 
Domain Number 3 Region: 258-366
Classification Level Classification E-value
Superfamily Cadherin-like 0.0000000000000471
Family Cadherin 0.003
Further Details:      
 
Domain Number 4 Region: 2-45
Classification Level Classification E-value
Superfamily Cadherin-like 0.00000143
Family Cadherin 0.0059
Further Details:      
 
Weak hits

Sequence:  ENSMMUP00000034911
Domain Number - Region: 355-425
Classification Level Classification E-value
Superfamily Family A G protein-coupled receptor-like 0.0275
Family Rhodopsin-like 0.039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000034911   Gene: ENSMMUG00000015092   Transcript: ENSMMUT00000041901
Sequence length 570
Comment pep:known chromosome:MMUL_1:6:21794036:21937295:-1 gene:ENSMMUG00000015092 transcript:ENSMMUT00000041901 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDREVKEQYQVLIQAKDMGGQLGGLAGTTIVNITLTDVNDNPPRFPKSIFHLKVPESSPI
GSAIGRIRAVDPDFGQNAEIEYNIVPGDGGNLFDIVTDEDTQEGVIKLKKPLDFETKKAY
TFKVEASNLHLDHRFHSAGPFKDTATVKISVLDVDEPPVFSKPLYTMEVYEDTPVGTIIG
AVTAQDLDVGSSAVRYFIDWKSDGDSYFTIDGNEGTIATNELLDRESTAQYNFSIIASKV
SNPLLTSKVNILINVLDVNEFPPEISVPYETAVCENAKPGQIIQIVSAADRDLSPAGQQF
SFRLSPEAAIKPNFTVRDFRNNTAGIETRRNGYSRRQQELYFLPVIIEDSSYPVQSSTNT
MTIRVCRCDSDGTILSCNVEAIFLPVGLSTGALIAILLCIVILLAIVVLYVALRRQKKKD
SLMTSKEDIRDNVIHYDDEGGGEEDTQAFDIGALRNPKVIEENKIRRDIKPDSLCLPRQR
PPVEDNTDIRDFIHQRLQENDVDPTAPPYDSLATYAYEGTGSVAESLSSIDSLTTEADQD
YDYLTDWGPRFKVLADMFGEEESYNPDKVT
Download sequence
Identical sequences ENSMMUP00000034911

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]