SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000034927 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000034927
Domain Number 1 Region: 5-189
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 7.46e-41
Family Calponin-homology domain, CH-domain 0.0000196
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000034927   Gene: ENSMMUG00000030203   Transcript: ENSMMUT00000041917
Sequence length 270
Comment pep:novel chromosome:MMUL_1:5:96641064:96641993:1 gene:ENSMMUG00000030203 transcript:ENSMMUT00000041917 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSSTQFNKGPSYGLSAEVKNRLLSKYDPQKEAELRTWIEGLTGLSIGPDFQKGLKDGTIL
CTLMNKLQPGSVPKINRSMQNWHQLENLSNFIKVMVSYGMNPVDLFEANDLFESGNMTQV
QVSLLALAGKMGTNKCASQSGMTAYGTRRHLYDPKNHILPTMDHSTISLQVGTNKCASQV
GMTAPGTRRHIYDTKLGTDKCDNSSMSLQMGYTQGANQSGQVFGLGRQIYDPKYCPQGTV
ADGAPSGAGDCPDPEEVPEYPPYYQEEAGY
Download sequence
Identical sequences ENSMMUP00000034927 9544.ENSMMUP00000034927 ENSMMUP00000034927

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]