SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000034956 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000034956
Domain Number 1 Region: 28-132
Classification Level Classification E-value
Superfamily SH2 domain 4.17e-27
Family SH2 domain 0.00044
Further Details:      
 
Domain Number 2 Region: 176-255
Classification Level Classification E-value
Superfamily PH domain-like 2.49e-23
Family Pleckstrin-homology domain (PH domain) 0.0000129
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000034956   Gene: ENSMMUG00000006829   Transcript: ENSMMUT00000041947
Sequence length 280
Comment pep:known_by_projection chromosome:MMUL_1:5:92772417:92826549:1 gene:ENSMMUG00000006829 transcript:ENSMMUT00000041947 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGRAELLEGKMSTQDPSDLWSRSDGEAELLQDLGWYHGNLTRHAAEALLLSNGCDGSYLL
RDSNETTGLYSLSVRAKDSVKHFHVEYTGYSFKFGFNEFSSLKDFVKHFANQPLIGSETG
TLMVLKHPYPRKVEEPSIYESVRVHTAMQTGRTENDLVPTAPSVSDLQLFNFLDTFKMKT
WKTRWFTLHRNELKYYKDQMSPEPIRILDLTECSAVQFDYSQERVNCFCLVFPFRTFYLC
AKTGVEADEWIKILRWKLSQIRKQLNRGEGMIRSRSFIFE
Download sequence
Identical sequences ENSMMUP00000034956

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]