SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000034959 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSMMUP00000034959
Domain Number - Region: 486-597
Classification Level Classification E-value
Superfamily SpoIIaa-like 0.00105
Family Anti-sigma factor antagonist SpoIIaa 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000034959   Gene: ENSMMUG00000017618   Transcript: ENSMMUT00000041950
Sequence length 645
Comment pep:novel chromosome:MMUL_1:3:145188886:145216152:-1 gene:ENSMMUG00000017618 transcript:ENSMMUT00000041950 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLLRKIIKRETDIIRHFWIISECVLASWLPAYRLKEWLLSDIVSGISTGIVSVLQGLAFA
LLVTIPPGYGLYAAFFSTIIYLFFGTSKHISAGPFPILSMMVGAATVRLAQNLPGNTGSS
NNSTSNSSSLDDYKVMVAASVTVLSGVIQLALGILRIGFVVIYLSESLISGFTTAAAVHV
LVSQLKFIFQLTVPSHEDPCSIFKVLYSVFSQIEKTNIADLVTALIVLLVVSIFKEINQR
FKDKLPVPIPIEFIVTVIATGVSYGFDFHRRFNVAVVGKMNPGFEPPNAPNVTVFQETIG
DCFAIAMVGFAVAFSVASVYSLKHDYPLDGNQELIALGLSNIVCGAFRGFAGSTALSRSA
VQESTGGKTQIAGLISAIVVLIVILAIGFLLEPLQRSVLAALALGNLKGMLMQFAEIRRL
WRKDKYDCLIWVTTCIFTIVLGLGLGLAASVAFQLLTIVFRTQFPKCSTLANIGRSNIYK
NKKDYYDMYELKGVKIFRCPSPIYFANIGFFKQKLIDAVGFSPLRILRKRNKALRKIRKL
QKQGLLQVTPILQEFIRIKVDVYIVGVDDDFIEKLNRYEFFDGEVKTSILFLTIHDAVLH
ISMKKDYSTSKFKPSQEKDGKIDFTINTNGGLRNREYQVRFFNRF
Download sequence
Identical sequences ENSMMUP00000034959

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]