SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000035005 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000035005
Domain Number 1 Region: 395-523
Classification Level Classification E-value
Superfamily TNF-like 3.23e-26
Family TNF-like 0.0016
Further Details:      
 
Domain Number 2 Region: 337-376
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000107
Family EGF-type module 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000035005   Gene: ENSMMUG00000022003   Transcript: ENSMMUT00000041998
Sequence length 524
Comment pep:known_by_projection chromosome:MMUL_1:5:82850569:82910140:1 gene:ENSMMUG00000022003 transcript:ENSMMUT00000041998 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKGARLFVLLSSLWSGGIGLNNSKHSWTIPEDGNSQKTMTSASVPPNKIQSLQILPTTWV
MSAEIATAPERAEGVVKLQNLTLPTKANIEFNPGAKPVVLSNSTLKFLQSFARKSNEQAT
SLNAVGGVGGTGGVGNRAPRETYLSRGDSSPSQRTDYQKSSFETTRGKNWCAYVHTRLSP
TVILDNQVTYVPGGRGPCGWTGGSCPQRSQKISNPIYRMQHKIVTSLDWRCCPGYSGPKC
QLRAQEQQHLIHTNQAESHTAVGRGVAEQQQQDCGDPEVMRKMTDQVNYQAKKLTLLQNK
IDNISLTVNDIRNTYSSLEGKVNEDKGREFQSLLKEEYSSCSRHPCQNGGTCINGRTSFT
CACRHPFTGDNCTIKLVEENALAPDFSKGSYRYAPMVAFFASHTYGMTTPGPILFNNLDV
NYGASYTPRTGKFRIPYLGVYVFKYTIESFSAHISGFLVVDGIDKLAFESENINSEIHCD
RVLTGDALLELNYGQEVWLRLAKGTIPAKFPPVTTFSGYLLYRT
Download sequence
Identical sequences ENSMMUP00000035005

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]