SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000035019 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000035019
Domain Number 1 Region: 10-52
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 5.46e-17
Family Higher-molecular-weight phosphotyrosine protein phosphatases 0.0036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000035019   Gene: ENSMMUG00000009004   Transcript: ENSMMUT00000042014
Sequence length 53
Comment pep:known_by_projection chromosome:MMUL_1:3:139763524:139777847:-1 gene:ENSMMUG00000009004 transcript:ENSMMUT00000042014 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLKRTDTRTYCHGVYGPKAYVATQGPLANTVIDFWRMIWEYNVVIIVMACREF
Download sequence
Identical sequences ENSMMUP00000035019

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]