SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000035053 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000035053
Domain Number 1 Region: 5-202
Classification Level Classification E-value
Superfamily Thioredoxin-like 3.21e-49
Family Phosducin 0.0035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000035053   Gene: ENSMMUG00000006271   Transcript: ENSMMUT00000042051
Sequence length 247
Comment pep:known_by_projection chromosome:MMUL_1:5:73811661:73837645:1 gene:ENSMMUG00000006271 transcript:ENSMMUT00000042051 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
DPNEDTEWNDILRDFGILPPKEESKDEIEEMVLGLQKEAMVKPFEKMTLAQLKEAEDEFD
EEDMQAIETYREKRLQEWKALKKKQKFGELREISGNQYVNEVTNAEKDVWVIIHLYRSSI
PMCLLVNQHLSLLARKFPETKFVKAIVNSCIQHYHDNCLPTIFVYKNGQIEAKFIGILEC
GGINLKLEELEWKLAEVGAIQTDLEENPQKDIVDMMVSSIRNTSIHDDSDSSNSDNPNRE
KYSVNSF
Download sequence
Identical sequences ENSMMUP00000035053 ENSMMUP00000035053 9544.ENSMMUP00000035053

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]