SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000035106 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000035106
Domain Number 1 Region: 620-653
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000015
Family EGF-type module 0.021
Further Details:      
 
Domain Number 2 Region: 441-486
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000206
Family EGF-type module 0.02
Further Details:      
 
Weak hits

Sequence:  ENSMMUP00000035106
Domain Number - Region: 717-749
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000133
Family EGF-type module 0.016
Further Details:      
 
Domain Number - Region: 749-781
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000384
Family EGF-type module 0.033
Further Details:      
 
Domain Number - Region: 813-845
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000908
Family EGF-type module 0.027
Further Details:      
 
Domain Number - Region: 685-716
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00108
Family EGF-type module 0.016
Further Details:      
 
Domain Number - Region: 477-505
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00206
Family EGF-type module 0.01
Further Details:      
 
Domain Number - Region: 653-684
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00349
Family EGF-type module 0.029
Further Details:      
 
Domain Number - Region: 781-813
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0201
Family EGF-type module 0.041
Further Details:      
 
Domain Number - Region: 589-619
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0594
Family EGF-type module 0.035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000035106   Gene: ENSMMUG00000030278   Transcript: ENSMMUT00000042108
Sequence length 849
Comment pep:novel chromosome:MMUL_1:3:113856868:113892135:1 gene:ENSMMUG00000030278 transcript:ENSMMUT00000042108 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRYNRQNRRKRQNFYEFLPLFAFPSLSQTDLEELTYFFPEDHTEDVQQEFVPSWPTPSGL
TEYSTLTVCQQTLANSSIGRLCLAFLGKRIDSVIDMCVKDVLLKDDLSWAEAGVALLENE
CERRIVEEGKYNTEEYGTSIEDILLVLKCPNLCSGNGQCMEWGCACSPSFTSYDCSDSYD
KAPEITELGNAGFCDVRKSNCMMVRVFGKGFKELPSIKCEVTKLQYNSSEWRPGEPIYTQ
TVFQNSRAVDCQLPNDVQQFDTMDLVGGKPIRKWQLKVSNDGYKFSNHKIMVIYDGACQF
CGLYKNDSCTVKENVCIINGLCYVEGDKNPTSACLICRPKISRFTWSFLENNQPPVIQVL
QDKLQTFYGENFEYQFVAFDPEGSDIHFTLDSGPEGASVSSAGLFMWKTELLTPQQFTLR
LNDDCDAETRVTIEVTVKSCDCLNGGSCVSDRNFPPGSGVYLCVCLPGFHGSLCEVNTSG
CQSNPCGLGSCISGFHNYSCDCPPELKVETQFLNKFTTHTVTKLKQESSCLTIQISETFA
SIITKSVPICMFCFTICRYPCGKSRECVAPNICKCKPGYIGSNCQTALCDPDCKNHGKCI
KPNICQCLPGHRGANCDEEHCNPPCQHGGTCLAGNLCTCPYGFVGPRCETMVCNRHCENG
GQCLTPDICQCKPGWYGPTCSTALCDPVCLNGGSCNKPNTCLCPNGYFGEQCQNAFCHPP
CKNGGHCMRNNVCICREGYTGRRCQKSICDPMCMNGGKCVGPNTCSCPSGWSGKRCNTPI
CLQKCRNGGECIAPSICHCPSSWEGVQCQIPICNPKCLYGGRCIFPNVCSCRTEYSGVTC
EKKIQVFQS
Download sequence
Identical sequences ENSMMUP00000035106 9544.ENSMMUP00000035106 ENSMMUP00000035106

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]