SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000035153 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000035153
Domain Number 1 Region: 15-99
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 2.43e-17
Family Eukaryotic type KH-domain (KH-domain type I) 0.0013
Further Details:      
 
Domain Number 2 Region: 108-184
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.0000000000394
Family Eukaryotic type KH-domain (KH-domain type I) 0.0026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000035153   Gene: ENSMMUG00000004839   Transcript: ENSMMUT00000042154
Sequence length 202
Comment pep:known_by_projection chromosome:MMUL_1:3:102885804:102917269:1 gene:ENSMMUG00000004839 transcript:ENSMMUT00000042154 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPPPTSGPPSAMTPPYPQFEQSETETVHLFIPALSVGAIIGKQGQHIKQLSRFAGASIKI
APAEAPDAKVRMVIITGPPEAQFKAQGRIYGKIKEENFVSPKEEVKLEAHIRVPSFAAGR
VIGKGGKTARVNELQNLSSAEVVVPRDQTPDENDQVVVKITGHFYACQARVAQRKIQEIL
TQVKQHQQQKALQSGPPQSRRK
Download sequence
Identical sequences ENSMMUP00000035153

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]