SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000035204 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000035204
Domain Number 1 Region: 1-90
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 4.56e-18
Family THAP domain 0.00069
Further Details:      
 
Weak hits

Sequence:  ENSMMUP00000035204
Domain Number - Region: 111-159
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.00759
Family Myosin rod fragments 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000035204   Gene: ENSMMUG00000009180   Transcript: ENSMMUT00000042205
Sequence length 180
Comment pep:known chromosome:MMUL_1:5:54056570:54068328:-1 gene:ENSMMUG00000009180 transcript:ENSMMUT00000042205 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVKCCSAIGCASRCLPNSKLKGLTFHVFPTDENIKRKWVLAMKRLDVNAAGIWEPKKGDV
LCSRHFKKTDFDRSAPNIKLKPGVIPSIFDSPYHLQEHSYSVMDSPKKLKHKLDHVIGEL
EDTKESLRNVLDREKRFQKSLRKTIRELKDECLISQETANRLDAFCWECCQESIEQDYIA
Download sequence
Identical sequences A0A2I3M1C7 A0A2K5I406 A0A2K5NCM5 A0A2K5VSB9 A0A2K5XGG1 A0A2K6DSY7 F6UHR7
ENSMMUP00000035204 XP_011782574.1.43180 XP_011821556.1.47321

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]