SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000035274 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000035274
Domain Number 1 Region: 97-287
Classification Level Classification E-value
Superfamily p53-like transcription factors 2.07e-89
Family p53 DNA-binding domain-like 0.00000000489
Further Details:      
 
Domain Number 2 Region: 319-357
Classification Level Classification E-value
Superfamily p53 tetramerization domain 0.0000000000144
Family p53 tetramerization domain 0.00019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000035274   Gene: ENSMMUG00000008639   Transcript: ENSMMUT00000042272
Sequence length 393
Comment pep:known chromosome:MMUL_1:16:7399793:7417985:-1 gene:ENSMMUG00000008639 transcript:ENSMMUT00000042272 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEEPQSDPSIEPPLSQETFSDLWKLLPENNVLSPLPSQAVDDLMLSPDDLAQWLTEDPGP
DEAPRMSEAAPPMAPTPAAPTPAAPAPAPSWPLSSSVPSQKTYHGSYGFRLGFLHSGTAK
SVTCTYSPDLNKMFCQLAKTCPVQLWVDSTPPPGSRVRAMAIYKQSQHMTEVVRRCPHHE
RCSDSDGLAPPQHLIRVEGNLRVEYSDDRNTFRHSVVVPYEPPEVGSDCTTIHYNYMCNS
SCMGGMNRRPILTIITLEDSSGNLLGRNSFEVRVCACPGRDRRTEEENFRKKGEPCHQLP
PGSTKRALPNNTSSSPQPKKKPLDGEYFTLQIRGRERFEMFRELNEALELKDAQAGKEPA
GSRAHSSHLKSKKGQSTSRHKKFMFKTEGPDSD
Download sequence
Identical sequences E3U906 G7PTI9 P56423 P56424 P61260
NP_001040616.1.72884 NP_001274608.1.63531 XP_005582844.1.63531 ENSMMUP00000011334 9544.ENSMMUP00000035274 ENSMMUP00000035274

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]