SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000035307 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000035307
Domain Number 1 Region: 419-532
Classification Level Classification E-value
Superfamily SH2 domain 5.39e-31
Family SH2 domain 0.000000631
Further Details:      
 
Domain Number 2 Region: 104-197
Classification Level Classification E-value
Superfamily Ubiquitin-like 1.19e-28
Family Ras-binding domain, RBD 0.00019
Further Details:      
 
Domain Number 3 Region: 224-356
Classification Level Classification E-value
Superfamily PH domain-like 0.0000000000000104
Family Pleckstrin-homology domain (PH domain) 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000035307   Gene: ENSMMUG00000019992   Transcript: ENSMMUT00000042308
Sequence length 535
Comment pep:known chromosome:MMUL_1:3:75569239:75770244:1 gene:ENSMMUG00000019992 transcript:ENSMMUT00000042308 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNASLDSLYSACSMQSDTVPLLQNGQHDRSQPRASGPRSVQPQVSPRQRVQRSQPVHILA
VRRLQEEDQQFRTSSLPAIPNPFPELCGPGSPPVLTPGSLPPSQAAAKQDVKVFSEDGTS
KVVEILADMTARDLCQLLVYKSHCVDDNSWTLVEHHPHLGLERCLEDHELVVQVESTMAS
ESKFLFRKNYAKYEFFKNPMNFFPEQMVTWCQQSNGSQSQLLQNFLNSSSCPEIQGFLHV
KELGKKSWKKLYVCLRRSGLYCSTKGTSKEPRHLQLLADLEDSNIFSLIAGRKQYSAPTD
HGLCIKPNKVRNEAKELRLLCAEDEQTRTCWMTAFRLLKYGMLLYQNYRIPQQRKALLSP
FSTPVRSVSENSLVAMDFSGQTGRVIENPAEAQSAALEEGHAWRKRSTRMNILGSQSPLH
PSTLSTVIHRTQHWFHGRISREESHRIIKQQGLVDGLFLLRDSQSNPKAFVLTLCHHQKI
KNFQILPCEDDGQTFFSLDDGNTKFSDLIQLVDFYQLNKGVLPCKLKHHCIRVAL
Download sequence
Identical sequences 9544.ENSMMUP00000035306 ENSMMUP00000026288 ENSMMUP00000035306 ENSMMUP00000035307 ENSMMUP00000026287 XP_005549636.1.63531 XP_005549637.1.63531 XP_014988975.1.72884 XP_014988976.1.72884 XP_015302894.1.63531 XP_015302895.1.63531

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]