SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000035398 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000035398
Domain Number 1 Region: 18-109
Classification Level Classification E-value
Superfamily WWE domain 7.06e-24
Family WWE domain 0.0013
Further Details:      
 
Domain Number 2 Region: 107-183
Classification Level Classification E-value
Superfamily WWE domain 3.27e-23
Family WWE domain 0.00095
Further Details:      
 
Domain Number 3 Region: 393-494
Classification Level Classification E-value
Superfamily RING/U-box 1.45e-19
Family RING finger domain, C3HC4 0.00000381
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000035398   Gene: ENSMMUG00000017570   Transcript: ENSMMUT00000042396
Sequence length 622
Comment pep:known chromosome:MMUL_1:3:49863242:49910420:-1 gene:ENSMMUG00000017570 transcript:ENSMMUT00000042396 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAMAPSPSLVQVYTSPVAVAVWEWQDGLGTWHPYSAAVCSFIEQQFVQQKGQRFGLGSLA
HSIPLGQADPSLAPYIIDLPSWTQFRQDTGTMRAVRRHLFPQHSAPGRGVVWEWLSDDGS
WTAYEASVCDYLEQQVARGNQLVDLAPLGYNYTVNYATQTQTNKTSSFCRSVRRQAGPPY
PVTTIIAPPGHTGVACSCHQCLSGSGTGPVSGRYRHSMTNLPAYPAPQHPPHRTAFVFGT
HQAFAPYSKPSLSGARSAPRLNTTNPWGAAPPSLGSQPLYRSSLSHLGLQHLPPGSSTSG
AVSASLPSGPSCSPGSIPATVPVQMPKPSRVQQALAGMTSVLMSAIGLPVCLSRAPQPAS
PPASRLASKSHSSVKRLRKMSVKGRTPKPEPQPEQVIKNYTEELQVPPDEDCIICMEKLS
AASGYSDVTDSKAIGPLAVGRLTKCSHAFHLLCLLAMYCNGNKDGSLQCPSCKTIYGEKT
GTQPQGKMEVLRFQMSLPGHEDCGTILIVYNIPHGIQGPEHPNPGKPFTARGFPRQCYLP
DNAQGRKVLELLKVAWKRRLIFTVGTSSTTGETDTVVWNEIHHKTEMDRNVTGHGYPDPN
YLQNVLAELAAQGVTEDCLEQQ
Download sequence
Identical sequences ENSMMUP00000035398 ENSMMUP00000035399

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]